KEGG   Burkholderia mallei 2000031063: DM57_09350Help
Entry
DM57_09350        CDS       T03522                                 

Definition
(GenBank) AMP-binding protein
Organism
bmai  Burkholderia mallei 2000031063
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1023920..1025719
Genome map
AA seq 599 aa AA seqDB search
MPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARSIAAWLSACGAA
RRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTA
ADAHALANCLAAPGDAVSTVGALRCEATDALEALDASAWSRPALDASAIAFLQYTSGSTG
EPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFM
APSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEP
VRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEA
SLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDAS
EAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHP
ALGAGAGAAFSIDADGERVVVVHEIKEAWLDDGLSAAALSARIRTALARAFDIAAPSVVL
VPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDASRGAA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtctaattttgccgaacacttcgaaaatcaagtcttgaagtatgggaatcgcagt
caatttgtttttctacacggaaaacccggtgattcggccggcgaggcgcggctcggctat
gcgcaactggatgcccgcgcgcgatcgatcgccgcgtggctgtcggcgtgcggcgccgcg
cgccggccggttctgctcgtctatcccgaaggcctcgcgtttgtggcggcttttctcggc
tgcctgtatgccggcgcgatcgccgtgccggtgcccgtgcccgcggacgcgcgcagcgtc
gagcgaaccaggcggatcgtccgcgatgcgggcatcgcgcttgcgctgacgccgacggcc
gccgatgcgcacgcgctcgcgaactgcctggctgcgcccggcgatgcggtctccacggtc
ggcgcgctgcgatgcgaggccaccgacgcgctcgaggccctcgatgcgagcgcgtggagc
aggccggcgctcgatgcctcggcgatcgcgttcttgcaatacacgtccggctcgacggga
gagcccaaaggcgtcgtcgtgtcacatcgtaatctgctgcacaacgaagcgcagattcag
cgtgtcgtggcgagcgacgccgatagcgtcgtgacgggatggctgccgcattttcacgac
atggggctgatcggcatgctgctgcatccgctgtacgtcggctgcgactgcgtgttcatg
gcgccgtccacgttcttgcggcgtcccgttcgatggctggaggccgcgacgcattacgcg
gccacgattacggtcgcgccgaacttcgcgtacgacctgtgcgcgcgcgccgtgaagcgc
gagcaactcggcgggctcgatctgtccgcgctgaaggtcgcgttgaacggcgcggagccg
gttcgcgcgaaaacgatcgaagcgttctcggcgcgtttcgcgccggtcggcttcgatgca
cgggcgttttcgccgtgctacgggatggccgaggtcacgttgctcgcgagcgcgggccgc
ccggcggcggcgcccgtgctgctcgatatcgacgcgcgggcgctcgagcgccatgaggca
tcgttggcgaagcccggtgccgaggcgttgcgcgtcgtgggcagtgggcgcgccgtcgat
ctcgatctgcgcatcgtcgatccgcaaacgcacgccgtggcggccgacgggcgcatcggc
gagatctggctgcgcggcgacagcgtcgcgcaaggctactggcgccgccccgacgcgagc
gaggcggcgttccgggcgcgcacggccgcaggcgacgggccgtatctgcggaccggcgat
ctcggtttcgtgcgggacggggagctgttcgtgaccgggcgcctcaaggacctgctgatc
gtcaacggccgcaacctctatccgcaggacatcgaggatttcgttcgcgagttgcatccc
gcgctcggcgcgggcgcgggcgcggcgttttcgatcgatgcggacggcgaacgcgtcgtc
gtcgtccatgaaatcaaggaggcgtggctcgacgatggcctttcggccgccgcgctgtcc
gctcgcatcaggacggcgctcgcgcgcgcgttcgacatcgcggccccgagcgtcgtgctc
gtgccgcgcggcggcgtgaagcgcacgacgagcggcaaggtgcagcgcggcctcacgcgc
gacgcgtttctggccgcgcggctgcgcgtgctgcacgaggatatccaggtgccggttcgg
tcgttgcgtgtggccgcgggcgagggcgtcgcgcaggatgcctcccggggcgccgcatga

DBGET integrated database retrieval system