KEGG   Bacillus megaterium DSM 319: BMD_2444Help
Entry
BMD_2444          CDS       T01219                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMD_2444
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMD_2444
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMD_2444
   00430 Taurine and hypotaurine metabolism
    BMD_2444
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BMD_2444
Enzymes [BR:bmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BMD_2444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2432036..2433439)
Genome map
AA seq 467 aa AA seqDB search
MPQWHPHREQKNLPDEFPVNPLFSRQGEVTIPRLRISDQGMLPETAYQIIHDEIALDGNA
RLNLATFVTTWMEPDAKRLYGESFDKNMIDKDEYPQTAAIEERCVRILADLWNSPNPDTT
MGVSTTGSSEACMLGGLALKRRWQKLRKSKGLSTERPNIVFSSSVQVVWEKFANYWDVEP
RYVNINADHPYLDPEGVIKAVDENTIGVVPILGVTYTGVYEPIAAIAKALDELQEKTGLD
IPIHIDAASGGFIAPFLQPDLIWDFRLPRVKSINVSGHKYGLVYPGLGWVIWREKEDLPE
DLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNFLRLGKDGYYAVQKTSQENALFLSKEI
GEMEAFEIIADGSDIPVLAWKLKEGYTPNWTLYDLSRQLRTYGWQVPAYPLPADMEEITI
MRIVVRNGFSRDLAHLFMVNFKQAVEFLNSLDRPVLKDTKYDNGFHH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaatggcatccgcatcgtgaacaaaaaaatttacctgatgaatttcctgttaat
ccacttttttctcgacaaggagaagtgacaattccaaggctgcgtatcagtgatcaaggt
atgcttccagaaacagcttatcaaattattcatgacgaaattgctttagacggaaatgcc
cgtttaaatttagctacgtttgttactacttggatggaacctgatgcaaagcgtttgtac
ggagagtcttttgataaaaatatgattgataaagatgagtatccgcagacagcggctatt
gaagagagatgcgtacgtattttagcggatttgtggaattcacctaatcctgatacaacg
atgggcgtttctactacaggttcatctgaagcttgtatgcttggcggactagcgttaaaa
agacgctggcaaaaactgcgtaaaagtaaagggctatcaacagaacggccgaacattgta
tttagttcatccgttcaagtggtgtgggagaagttcgcaaactattgggacgtagagcct
cgttatgtgaacattaatgcagatcatccttatttagatccagaaggcgtcattaaggcc
gttgacgaaaatacaattggtgtcgtaccgattcttggagtgacgtatacaggagtttac
gagccaattgctgctatcgcaaaagcattagatgagttacaagaaaaaacagggttggat
attcctatccatatagatgccgcttctggaggttttatcgctccatttcttcaaccagac
cttatctgggatttccgcttgccgcgagtaaagtctattaacgtgtcaggacacaagtat
ggtttagtttaccctggcttgggatgggtgatttggagagaaaaagaggacttgcctgaa
gatcttattttccgcgtttcttatttaggaggcaacatgccaacttttgcgctcaacttt
tctagaccaggagcacaagttcttttacagtactacaatttcttgcgtttagggaaagac
ggctattatgccgtacaaaaaacttcacaagaaaacgccctgtttctaagcaaagaaatt
ggagaaatggaagcattcgaaattatcgccgatggttcagacatccccgttcttgcttgg
aaactaaaagaaggatacacaccaaactggactctttatgacttgtctagacaattgcgc
acgtatggatggcaagtgcctgcttatccactgccagcagatatggaagaaataacaatc
atgcgtattgtcgttagaaatggattttcaagggaccttgctcatttatttatggttaat
ttcaaacaagccgttgaatttcttaactcgttggatagacctgttcttaaagacacgaaa
tacgacaatggatttcatcattaa

DBGET integrated database retrieval system