KEGG   Bacillus megaterium DSM 319: BMD_4938Help
Entry
BMD_4938          CDS       T01219                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bmd  Bacillus megaterium DSM 319
Brite
Enzymes [BR:bmd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BMD_4938 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FlgD_ig DUF1860
Motif
Other DBs
NCBI-ProteinID: ADF41738
UniProt: D5DLY3
LinkDB All DBs
Position
complement(4761310..4761834)
Genome map
AA seq 174 aa AA seqDB search
MKKLLLIGTVPFFLLTGCMEKEISNKEVKVYNADGDSIGTVKLKEQADGIEFTYDLSGLP
PGEHGVHIHEMGICKAPNFKSAGNHLDPDKKKHGLLNPKGPHLGDMKNIVVEDDQTYKGT
DMVPQVTLKEGKTSLVKRMDGSSLVITEQGDDGMTEPSGNSGKRIACGIISKKH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactactactcattggaaccgtgccttttttcttgttaacggggtgtatggaa
aaagaaatatccaataaagaagtcaaagtctataacgcagatggagatagcatcggtaca
gttaagttgaaagagcaggctgatggaattgagtttacttacgatttaagcggacttcca
cctggggaacacggcgtacatattcatgaaatgggaatttgcaaagctcctaactttaaa
agtgcaggaaaccaccttgatcctgataaaaagaaacacggactgttaaatccaaaagga
ccgcatttaggcgatatgaagaatattgtggtagaagacgatcagacgtataaaggaacg
gatatggttcctcaagtcacgttaaaagaaggaaagacatctctcgttaagcgtatggat
ggttcctcccttgttattaccgaacaaggtgatgacggaatgacagagccatcaggtaat
tctggaaagcgaatcgcgtgtggaattatttcaaaaaaacattaa

DBGET integrated database retrieval system