KEGG   Bacillus megaterium DSM 319: BMD_5156Help
Entry
BMD_5156          CDS       T01219                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00240  Pyrimidine metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMD_5156 (tdk)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BMD_5156 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 IMPDH AAA_14 AAA_22
Motif
Other DBs
NCBI-ProteinID: ADF41955
UniProt: D5DM71
LinkDB All DBs
Position
complement(4970484..4971110)
Genome map
AA seq 208 aa AA seqDB search
MVYVMKQSGWIEVICGSMFSGKSEELIRRVRRTQFAKQKAQVFKPAIDNRYSEEAVVSHN
GTSVMAYSISASRDILKRVDEETDVVAIDEVQFFDTDILEIVQSLADQGFRVIVAGLDQD
FKGEPFGQMPQLMAIAESVTKLQAVCASCGSPASRTQRLINGEPASYDDPIILVGASESY
EPRCRHCHVVQKSKGQAVSVDSSEMVKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtacgtaatgaaacaaagcggttggatagaagtaatttgtggcagtatgttttca
gggaaatcagaagagttaattcgacgtgtgcgccgcacgcagtttgctaaacaaaaagca
caagtgttcaagcctgcaatcgataatcgatatagcgaagaagcggtcgtttcacataat
ggtacatctgttatggcttattcaatctcggcatcgcgcgatattttaaagcgagtagat
gaagagacagacgtagtagcgatagatgaagtacagttttttgacacagatattttagaa
attgttcaatctttagcggatcaaggctttcgtgtgattgtagcggggttagatcaagac
ttcaaaggtgaaccttttggacaaatgccgcagttaatggctattgcagagtcggtaaca
aagctacaggctgtctgcgcttcatgtggctctcctgcgagccgtacgcagcgtttgatt
aacggtgagcctgcttcttatgacgaccctattattttagtcggtgcgtctgaatcgtac
gaaccaagatgtcgtcattgccacgttgtgcaaaagtctaaaggacaagctgtgtctgtg
gactcaagcgaaatggttaaaaaataa

DBGET integrated database retrieval system