KEGG   Burkholderia metallica: WJ16_19040Help
Entry
WJ16_19040        CDS       T04871                                 

Definition
(GenBank) AMP-binding protein
Organism
bmec  Burkholderia metallica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:720346..722151
Genome map
AA seq 601 aa AA seqDB search
MARASVFLKGRILVTKCASTIHRLIESLEDVAGALHRMTFVDEAGNEAGITYRRFAEEVF
RQAGALRELGVRENDLVMLALPASVEHAAAMMACVMTGALPCTVPVPARRAAAGRQVIDV
ACELYRPRVVIAADAQAAAWRDAAFPASSTRVVDLEMLSSAADAGGRALISAKHGRDPHH
VQLTSGSTSHPKAAVLSHENVIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSN
MHYRAPLLMMQPNSFIRNPLGWLKRIASARATTTSVPTFALRYCVRRFNAAAMEGVDLSA
CRNIFIGGERVDDATLRDFAATFAPYGLAASALQPCYGMAESTLAVSMHRAWHDGAIDGA
PYVIADTLDRRALIERRDAQPAAANDGAAATDTETVLAMGTPIDGMAFRILDDGDHALAN
RAVGEVAIRGTSVMLGYLNPDDGSIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIII
RGSNYFPHEIEEALASHRTLRKSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRAECQ
QLLASRIGFAAQDLCFVEPGSLPRTTSGKLQRVKCRDLYANGALPVIHAPAAAEAGHGAY
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgagcgtccgtgttcctcaaggggagaatcctcgtgacgaagtgcgcatccacc
attcatcgcctgatcgaatcgctcgaggacgtcgcgggcgcgctgcaccgcatgacgttc
gtcgacgaggccggcaacgaggcgggcatcacgtaccggcgcttcgcggaagaagtgttt
cgccaggccggcgcgctgcgcgaactcggcgtgcgcgagaacgacctggtgatgctcgca
ttgcccgcgtcggtcgagcatgcggccgcgatgatggcctgcgtgatgacgggcgcgctg
ccctgcaccgtgcccgttcccgcgcgccgcgccgccgccgggcggcaggtgatcgacgtc
gcctgcgagctgtaccggccgcgagtcgtcatcgccgcggatgcgcaggccgccgcgtgg
cgcgacgctgcattccccgcgtcctccacccgcgtcgtcgatctcgagatgctgtcgagc
gccgcggatgccggcgggcgcgcgctgatcagcgcgaagcacggccgcgacccgcatcac
gtacagctcacgtcgggttcgacgtcgcacccgaaggccgcggtgctcagccacgagaac
gtgatcgcgaacgtgctcggcatcggcggatcggtgcgtttcgacatcgcggccggcgac
ggcactgcatcgtggctgccgctctatcacgacatggggctgctcacgctgctgtcgaac
atgcattaccgcgccccgctgctgatgatgcagccgaacagcttcatccggaatccgctc
ggctggctgaagcgcatcgcgtcggcacgcgcgacgaccacgtcggtgccgaccttcgcg
ctgcgctactgcgtgcgccgtttcaatgccgccgcgatggaaggcgtggacctgtccgcg
tgccgcaacatcttcatcggcggcgaacgcgtggacgacgcgacgctgcgcgacttcgcg
gcgacgttcgcgccgtacggtctcgccgcatcggcgctgcagccgtgctacggaatggcc
gaatcgacgctcgcggtatcgatgcatcgtgcgtggcacgacggcgcgatcgacggcgcg
ccgtacgtgatcgccgacacgctcgaccggcgcgcgctgatcgagcgccgcgacgcgcag
ccggccgccgcgaacgacggcgccgccgccaccgacaccgaaaccgtgctcgcgatgggc
acgccgatcgacggcatggcgttccggattctcgacgacggcgaccatgcgctggcgaac
cgcgcggtgggcgaagtcgcgatccgcggcacgtcggtgatgctcggctacctgaacccc
gacgacggctcgatcgccgcgccgctgacggccgacggctggttccgcaccggcgacatc
ggctacgtcgcggacggccagcttcatatcctcgggcgcaagaaggaagtcatcatcatt
cgcggcagcaactactttccgcacgaaatcgaggaggcgctcgcgtcgcatcgcacgctg
cgcaagagcacctgcatcgcgttcgggctgcccgaccccgagaccggcaccgagcggctg
gtcgtcgcgatcgaagcgcggcccgtcgatgcgacgccgcagacgcgcgccgagtgccag
caactgctcgcgtcgcgcatcggcttcgccgcgcaggatctgtgcttcgtcgaacccggc
tcgctgccgcgcacgacgagcggcaagctgcagcgcgtgaagtgccgcgacctgtatgcg
aacggcgcgctgcccgtgatccacgcgccggcggccgccgaagccggccacggagcgtac
gcatga

DBGET integrated database retrieval system