KEGG   Burkholderia metallica: WJ16_24710Help
Entry
WJ16_24710        CDS       T04871                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmec  Burkholderia metallica
Pathway
bmec00440  Phosphonate and phosphinate metabolism
bmec01100  Metabolic pathways
bmec01120  Microbial metabolism in diverse environments
bmec01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmec00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WJ16_24710
Enzymes [BR:bmec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WJ16_24710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AOJ34767
UniProt: A0A1B4I2Y8
LinkDB All DBs
Position
2:complement(1116245..1117930)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAADRLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAEDDRGLFGQKVYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVERLKAMLATLQARPDFDTLDIPALLNELVAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaagccggcttcaaggggatctgggcatcgggcctcgcgatttccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgcgggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgccgaaatc
gacgaattctgcggcaagatcaaggccggcaaggattcccagaccgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcggaagccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
ccagacgaaatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcgtccgcgatgcaggcgaccgcgcgcgaa
atccacgagagcgaaacgctgatcaacgtcgaggaccgcgtcgcatcggtcaacgaaatt
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggtcggcggctatcgc
gcggacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccatgcgcagacg
ggcgaactcgcgtcgctcgcgtgcgcggccgatcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggaaagcgaggcggag
ttcagcgtggtggtcgattcgtcgctcaccgagaccaaccagagcgtgcgcgatttcgcg
ctctgctcggccgaggacgatcgcggcctgttcggccagaaggtgtacctgcaacgcgtg
tcgagcgacgtcgccgcaggcacgccgcacggccgctggatcggtctcctgaacgtgcgc
ggcgcaggcgtggagcgcctgaaggcgatgctcgcgacgctgcaggcgcgccccgacttc
gacacgctcgacatcccggcgctgctcaacgaactcgtcgcagccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtccgaaccgggcaccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system