KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_2492Help
Entry
BG04_2492         CDS       T03825                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00473  D-Alanine metabolism
bmeg00550  Peptidoglycan biosynthesis
bmeg01100  Metabolic pathways
bmeg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BG04_2492
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BG04_2492
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BG04_2492
Enzymes [BR:bmeg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BG04_2492
Peptidoglycan biosynthesis and degradation proteins [BR:bmeg01011]
 Precursor biosynthesis
  Amino acid ligase
   BG04_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AJI21061
UniProt: A0A0B6ABZ2
LinkDB All DBs
Position
2312235..2313317
Genome map
AA seq 360 aa AA seqDB search
MKIKLGLLYGGKSAEHKVSLQTALAVSKAINHDKYEVHPIYITETGKWIRGTQLTGPLET
VAQLEIQDNGTAISPVSLNTEMFALTDSKTDDQLDVIFPLLHGPNGEDGTVQGLLELLNI
PYVGNGVLASAAGMDKVVMKQLFAQAGLPQVEYVSFIRREWEADRTAAYEKVETLGYPCF
VKPANLGSSVGISKCDNRDELEAAFVEAFLFDRKIIVEAAAIGREVEIGVLGNDDAACSV
VGEILPKKAFYDYKAKYEDGDTGLIIPAEITEEQHQEMSALAIKAFKAIDGSGLVRADFF
LTSEGKFIINEVNTMPGFTPFSMFPLLWKHAGVEYPDLIEKLVSLAIERHTEKQQIKHTM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaagcttggccttttatacggaggaaaatccgctgaacataaagtatcttta
caaacagctctagcagtttcaaaagcaattaatcacgataaatatgaagtgcatccaatt
tacattacagaaacaggaaagtggattcgcggcacacagctgactggtccgcttgaaacg
gttgctcaattagaaattcaagataatggaactgctatttcaccagtttcattgaatacg
gaaatgtttgcattaacagattcaaaaacagatgatcagctagatgttattttcccactt
cttcatggtccaaatggagaagatggtacggtacaaggattattagaattattgaatatt
ccttatgttggaaacggcgtattagcttcagcagctggtatggataaagttgtaatgaag
cagctgtttgcacaggcaggtctccctcaagtagagtacgtatcatttatccgccgcgag
tgggaagcagatcgaacagctgcttatgaaaaagtagaaacacttggatacccttgcttt
gttaaaccagcaaatttaggttcaagcgttgggattagcaaatgtgataaccgcgacgag
ttagaagcagcatttgttgaagctttcttattcgatcggaaaatcattgtagaagcagca
gcaattggtcgtgaagttgaaattggtgtgttaggtaatgatgatgcagcttgttcagta
gttggagaaatcttacctaaaaaagcgttttacgattacaaagccaaatatgaagacggc
gatacaggccttattattccagctgaaattacagaagaacagcatcaagaaatgtcagca
ctagcaatcaaagcatttaaagcaattgatggatctggtcttgtacgtgcagatttcttc
ttaacatcagaaggtaaattcattattaatgaagtgaatacaatgcctggttttacacct
ttcagtatgttcccgttattgtggaaacacgcaggtgttgaatatccagatttaatcgaa
aaacttgtatcactagcaattgaacgtcataccgaaaagcagcaaattaaacacacaatg
taa

DBGET integrated database retrieval system