KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_4039Help
Entry
BG04_4039         CDS       T03825                                 

Gene name
aldHT
Definition
(GenBank) aldehyde dehydrogenase, thermostable
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BG04_4039 (aldHT)
Enzymes [BR:bmeg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BG04_4039 (aldHT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC P-II RRM_1
Motif
Other DBs
NCBI-ProteinID: AJI21652
UniProt: A0A0B6AKQ9
LinkDB All DBs
Position
3881706..3883172
Genome map
AA seq 488 aa AA seqDB search
MNITTEEKMYLNYIDGDWVTGSVEQVDSSTNPANRHDVVGYVQHSEKEDLDRAVASAKKA
QVSWNKLSGAARGEYLYKVANMLEQRLDEIAKTMTREMGKTFPEAKGETARGVAILRYYA
GEGLRKVGDVLPSTDSEAFMYTTRAPLGVVGVITPWNFPVAIPIWKIAPALIYGNTVILK
PAREAAVTAAKVMECFAEAGLPRGVINMVTGSGSVIGQGIIDHPDINGITFTGSDAVGKQ
VGLGALKRGAKYQLEMGGKNPVIVANDADIEQAVEATISGGLRSTGQKCTATSRVIVQSK
IYDEFKEKLIEQVKEIKVGNGLEKDVWMGPCASEDQLNTVLAYVEKGVEEGASLVYGGKR
LVEGNLADGFYMEPTIFENVTSGMTIAQEEIFGPVLALMKVETLEEALNVANDVKFGLSA
SIFTKSIGRMLSFVNEMDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGQAAIEFFTS
IKTVFVKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaatataacaacagaagagaaaatgtatttaaactatattgatggagactgggtaacg
ggttctgtggagcaagtggatagcagtaccaatcctgctaatcgacatgatgtagtcggt
tatgtacagcattctgaaaaagaagatttagatcgcgctgttgcttctgctaaaaaagct
caggtttcctggaataaactgtccggggctgctcgtggtgaatatttgtataaagtagca
aatatgcttgagcagcgcctagatgaaatagcaaagacaatgacccgcgagatgggaaaa
acatttccagaagcaaaaggtgaaactgcaagaggggtcgcaattcttcgctactatgca
ggagaaggtctaagaaaagtgggagatgtcctaccttcaacagactctgaagcatttatg
tacacaacccgtgctcctcttggggtagtgggtgttattacaccttggaatttcccagta
gctattcctatttggaagattgctcctgctcttatttatggaaatactgttattttgaag
ccagctcgagaagcagcagttactgctgcaaaagttatggaatgttttgcagaggcaggt
ttgccacgtggtgtgattaatatggtaacgggttctggttctgttatcggacaaggtatt
attgatcatccagatattaatgggattacgtttacagggtctgatgcagtcggtaaacaa
gttggtttaggcgcactaaaacgtggtgcaaaatatcaattagagatgggcggaaaaaat
ccagttatcgttgctaacgatgccgatattgaacaagcagtagaggcaactattagtgga
ggattgcgttccactggacaaaaatgtacagctacaagtcgtgtaattgtacaaagtaaa
atttatgatgaatttaaagaaaagctgattgaacaagtgaaagaaataaaagttggaaat
ggccttgaaaaagatgtttggatggggccttgtgcaagtgaagaccagcttaacacggta
cttgcctacgtagaaaaaggtgttgaagaaggggcttcgttagtttatggaggtaaacgt
ctagttgaagggaatttggctgatggtttctatatggagcctactatattcgaaaacgtg
actagtggtatgactatcgctcaagaggaaatctttggtccagtacttgcccttatgaaa
gttgaaacgttagaagaagcactgaatgttgcaaatgatgtaaagtttggactcagtgct
tccattttcacgaaatcaattgggcgtatgctttcattcgtaaatgagatggatgctggt
cttgtgcgtatcaatgcagaatctgccggggtagaattacaagcaccattcggaggaatg
aaacaatctagctctcactctcgtgaacaaggtcaagctgcaattgaattctttacttct
attaaaacagtatttgtaaaaccgtaa

DBGET integrated database retrieval system