KEGG   Brucella melitensis bv. 1 16M: DK63_633Help
Entry
DK63_633          CDS       T03831                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel00730  Thiamine metabolism
bmel00790  Folate biosynthesis
bmel01100  Metabolic pathways
bmel02020  Two-component system
Module
bmel_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DK63_633 (phoA)
   00790 Folate biosynthesis
    DK63_633 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DK63_633 (phoA)
Enzymes [BR:bmel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DK63_633 (phoA)
Exosome [BR:bmel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK63_633 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bmel00537]
 Enzymes
  DK63_633 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase DUF5300
Motif
Other DBs
NCBI-ProteinID: AIJ89176
UniProt: Q8YHK7
LinkDB All DBs
Position
1:645561..647006
Genome map
AA seq 481 aa AA seqDB search
MPRKFTRPLLASAAIIVTFCAPASTVMAQSETAAPLFQRSAKGDLSAAGGARRLDGDITA
AFRDQIRKGPARNVILLIGDGMGDSEITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDK
ESGKPNYVTDSAASGTAWATGVKTYNGAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAEL
QDATPAVQVAHVTHRKCYDPTSTAEKCKDNALENGGPGSISEQLLNTRPDVTLGGGAKYF
EDKARAGTWKGQTLSAQAEARGYQLVRNADALSKVETANQDKPVLGLFSPGNMPVRWKGP
QAAHHGNLDREPVKCKVNEKRTADIPTLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDH
AANPCGQIGETVDLDEAVQAALDFARKDGNTLVIVTADHAHASQIIDPDAKAPGLSQALK
TEDGAIMGVTYGNSDEADDQGHTGAQLRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQA
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaattcacccggccacttctggcaagcgctgcaattattgtcaccttttgc
gcacccgcaagcaccgtgatggcccagtctgaaactgcggctccactcttccagcgcagc
gcaaaaggcgacctgtcggcagcaggcggcgcacgccgccttgatggtgatattaccgca
gcttttcgcgatcagatcaggaaggggcctgccagaaacgtcatcctgctgatcggagac
ggcatgggcgattccgagatcacggttgcgcgcaattatgcagtcggcgcaggcaatcat
ttcaagggcatcgatgcccttcccgttaccggccagtacacccattattcgctcgacaag
gaaagcggcaagccgaattacgtgactgattctgccgcctccggcaccgcctgggccact
ggcgtcaaaacctataacggcgccatcggcgtcgatattcatggcaaaccgcacaaaacg
ctcattgaactcgccaaggaaaagggcctcggcaccggcaatgtcagcactgccgaattg
caggatgccacacccgccgtgcaggttgcccatgttacccatcgcaagtgctacgaccca
accagcacggcggaaaagtgcaaggataatgcgcttgaaaatggcggcccaggctcgatc
agcgaacagcttttgaacacccgcccggacgtgacattgggcggcggcgcaaaatatttc
gaggacaaggcccgggctggcacatggaaaggccagactttgagcgcacaggccgaagca
cgcggctatcaactggttagaaatgccgacgcattgagcaaggtcgagacagccaatcag
gacaaacctgttctcggcctcttctcaccgggcaacatgccggtccgctggaaagggcct
caggccgcccatcacggcaatctcgacagagagcctgtcaagtgcaaggtcaatgagaag
cgcactgccgatattccgacactggcgcaaatgaccgagaaagccatcgacctgctgaaa
accaacgaaaaaggctttttccttcaggtggaaggtgcctccatcgacaaacaggaccat
gccgccaatccgtgcgggcagatcggcgaaacagtcgatctggatgaagccgtgcaggcc
gcactcgattttgcccgcaaagacggcaacacgcttgtcatcgtaacggccgatcacgcc
catgcaagccagatcattgatcccgatgcgaaggctccgggtttgagccaggcattgaaa
accgaggatggcgcgatcatgggcgtgacctatggcaattccgacgaagccgacgatcag
ggccacacaggcgcgcaattgcgcatagccgcctttggccccggcgctgccaattttacc
ggcctcacggatcagacggatatgttctacacgatccgcgatgccttgcagttgcaggcg
gaataa

DBGET integrated database retrieval system