KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03021Help
Entry
BMULJ_03021       CDS       T00740                                 

Gene name
tufA
Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
Translation factors [BR:bmj03012]
 Eukaryotic Type
  Elongation factors
   BMULJ_03021 (tufA)
 Prokaryotic Type
   BMULJ_03021 (tufA)
Mitochondrial biogenesis [BR:bmj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BMULJ_03021 (tufA)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BMULJ_03021 (tufA)
  Exosomal proteins of breast cancer cells
   BMULJ_03021 (tufA)
  Exosomal proteins of colorectal cancer cells
   BMULJ_03021 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C
Motif
Other DBs
NCBI-ProteinID: BAG44905
UniProt: A0A0H3KI80
LinkDB All DBs
Position
1:complement(3255626..3256816)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGETAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaaattcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggttctgtcggcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcacgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcgcacgtc
gactgcccgggccacgccgactacgtgaagaacatgatcacgggtgcagcgcagatggac
ggcgcgatcctggtgtgctcggctgcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcaaagctggcgctggaa
ggcgacaagggcgagctgggcgaaacggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgcgcggtcgacggtacgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggtacggtggtgacgggtcgtgtcgagcgcggcgtgatcaag
gtcggtgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggatcaaggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggccgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgattgcgccgatcgcgatggaagaaggtctgcgcttcgctatccgt
gaaggcggccgtaccgtcggtgctggcgtcgtcgcaaagatcatcgagtaa

DBGET integrated database retrieval system