KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_03876Help
Entry
BMULJ_03876       CDS       T00740                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(732832..733557)
Genome map
AA seq 241 aa AA seqDB search
MRYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVSAMMRMMDSTKAECVPFA
PPFLKAGDVVIGQTANILLFLGTRLGLAPDDEAGRLWVHQLQLTIADFVTEIHDTHHPIG
SGLYYEDQKAEAAERSADFLAHRLPKFLGYFERVLAQNPHKSGYLAGDALSYADLSTFQL
IEGLRYAFPKAMKREERKVAGLVALHDRVAQHPPIARYLASERRIPFNDMGIFRHYPELD
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatgaactctattactggcccgagatccagggccgaggcgaatacgtacggctc
gcgctcgaagcggccgaagcggactacgtcgacgtcgcgcgcgagtcggggcgcggcatg
ggcgtgtcggccatgatgcggatgatggacagcacgaaggccgaatgcgtgccgttcgcg
ccgccgtttctgaaggccggcgacgtcgtgatcgggcagactgcgaacattctgctgttt
ctcggcacgcggctcggcctcgcgcccgacgacgaagcgggacggttgtgggtgcatcaa
ctgcagctgaccatcgccgacttcgtcaccgagattcacgatacgcaccacccgatcggc
agcggtctgtactacgaggatcagaaggcggaagccgccgagcgctcggccgatttcctc
gcgcatcgtctgccgaagtttctcggttatttcgagcgcgtactcgcgcagaatccgcac
aagagcggctacctcgccggcgacgcgctcagctatgcggatctgtcgacgttccagctg
atcgaagggctgcgttatgcgttcccgaaggcgatgaagcgcgaggagaggaaagtcgcc
gggctcgtcgcgctgcatgatcgcgtcgcacagcatccgccgattgcgcgctatctcgcg
tcggaacgtcgcatcccgttcaacgacatgggaatcttccggcactaccccgagctggac
gcgtag

DBGET integrated database retrieval system