KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0711Help
Entry
BMA10229_A0711    CDS       T00471                                 

Definition
(GenBank) glutathione S-transferase N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BMA10229_A0711
Enzymes [BR:bml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BMA10229_A0711
Transporters [BR:bml02000]
 Other Transporters
  Pores ion channels [TC:1]
   BMA10229_A0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABN03074
UniProt: A2S433
LinkDB All DBs
Position
I:complement(732692..733366)
Genome map
AA seq 224 aa AA seqDB search
MMKETSMLRLCGFPVSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADTPLGKVPYLM
TEHGSLCESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFF
GGKVSDGTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIY
GRDFVVDAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggagacttcgatgctgcggctttgtggttttccagtgtccaattattacaac
aaggtcaagttcgtcctgctcgagcacgacattccgttcgaagcgtcgatcgtcagcgtc
ccgatcaaggaccccgcgtttttggccgatacgccgctcggcaaggtgccgtatctgatg
accgagcacggctcgctgtgcgaatcgcaggcgatcatcgaatatcttgccgcgattcat
cccgacaagcccattttcccggccgatccgttcgcggcggcgaaggcgcgcgagatcacg
gcggtgctcgagctgtacctcgaatggaacgtgcgcgaactgtttccggaggcgttcttc
ggcggcaaggtgagcgacggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctg
gacggtttcaagcggctcgcgaaattttcgccgtacgtgctcggcgatacgttctgcatt
gccgacatcgccgcgttcatccatctgccggtcgtcgcgctcgcgacgaaggcgatctac
ggccgcgatttcgtcgtcgacgcggggatcgactggaaggcgtacgtgaagcgcatcgag
gaagcgcggccggccgcgaagcgcgtgagcgacgagcgcaaggcgttcgtcgcggggctc
gcgaagccgggctga

DBGET integrated database retrieval system