KEGG   Burkholderia mallei NCTC 10247: BMA10247_0441Help
Entry
BMA10247_0441     CDS       T00479                                 

Definition
(GenBank) glutathione S-transferase N-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BMA10247_0441
Enzymes [BR:bmn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BMA10247_0441
Transporters [BR:bmn02000]
 Other Transporters
  Pores ion channels [TC:1]
   BMA10247_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:427626..428282
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADTPLGKVPYLMTEHGSL
CESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIYGRDFVV
DAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctttgtggttttccagtgtccaattattacaacaaggtcaagttcgtcctg
ctcgagcacgacattccgttcgaagcgtcgatcgtcagcgtcccgatcaaggaccccgcg
tttttggccgatacgccgctcggcaaggtgccgtatctgatgaccgagcacggctcgctg
tgcgaatcgcaggcgatcatcgaatatcttgccgcgattcatcccgacaagcccattttc
ccggccgatccgttcgcggcggcgaaggcgcgcgagatcacggcggtgctcgagctgtac
ctcgaatggaacgtgcgcgaactgtttccggaggcgttcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctggacggtttcaagcggctc
gcgaaattttcgccgtacgtgctcggcgatacgttctgcattgccgacatcgccgcgttc
atccatctgccggtcgtcgcgctcgcgacgaaggcgatctacggccgcgatttcgtcgtc
gacgcggggatcgactggaaggcgtacgtgaagcgcatcgaggaagcgcggccggccgcg
aagcgcgtgagcgacgagcgcaaggcgttcgtcgcggggctcgcgaagccgggctga

DBGET integrated database retrieval system