KEGG   Burkholderia mallei NCTC 10247: BMA10247_1599Help
Entry
BMA10247_1599     CDS       T00479                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxykinase (GTP)
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMA10247_1599 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMA10247_1599 (ppc)
   00680 Methane metabolism
    BMA10247_1599 (ppc)
Enzymes [BR:bmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BMA10247_1599 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:1587455..1590439
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPAHAEPPARRAAKPARKLDGAAARPLAPTNAASAKPQGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAAQAGTVAYALDKLKQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARELAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYADIEEALAEHGLRA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAISRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGTVPVRSAGRGAAP
VRATPYADAEEFAADLRVLTDSLALHHGESLATPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVVAELLARGGVEADYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGTPHANARNGLMVIP
LFETIADLRNASDIMRAFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFDERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEAAMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVAAYLDGAPDAAERGKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTADALAEITGAHARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcttccgcc
ccggcgcacgccgagccccccgcccgccgcgccgcaaaacccgcacgcaagctcgacggc
gccgccgcgcgcccgctcgcgccgacgaacgccgcatccgcgaaaccgcagggccgcacg
cgcgaagacaaggaccgcccgctcttcgaggacattcgctatctcggccgcctgctcggc
gacgtcgttcgcgaacaggaaggcgacgccgtgttcgacgtcgtcgagacgattcgccag
accgcggtcaagttccgccgcgaggacgacaaggctgccgcgcagacgctcgagaaaatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccatcacaaccgccgccgccgcatccacgcgctc
gcgggctccgcggcgcaggcgggcaccgtcgcgtacgcgctcgacaagctcaagcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgaaggcgcgctgatcgtgcccgtg
ctcaccgcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctgaccgcgcgcgagctcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgc
ctgaccgtcgccgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacgcggacatcgaggaggcgctcgccgagcacggcctgcgcgcg
cgcgtgccggcgttcttccagatgggcagctggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcagccgccaggcggcggtgatcttcgag
cattacctcgaacaggtgcacaagctcggcgcggagttgtccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctcaaggcgctcgccgccgcgtcgccggaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggctcgcggccagcgcg
cgcgtgcggctcggcgagggcacggtgcccgtgcgcagcgcgggccgcggcgccgcgccc
gtgcgcgcgacgccgtacgcggacgcggaggagttcgccgccgatctgcgcgtgctgacc
gattcgctcgcgctgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgttcggcttccatctcgcgagcatcgatttgcggcagagctcggac
atccatgaagcggtggtcgccgaactgctcgcgcgcggcggcgtcgaggccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaaaagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcacgcgcggtgcgcaactacatcatttcg
cataccgagacagtgagcgatctcgtcgaggtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcacgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgcgttcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctatcgcgcg
gaactggcgctcgtcgatctgttcgacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggacgcggcggcggcccgacctatcaggcgatcctgtcgcagccg
cccggcacggtaaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaacccggagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgcccgcgttcgaggcggcgatg
cagacgctgtcggacgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccggcccgcgtcgcgcaagctgcaggatccgaagaaccgcaagatcgaggacctgcgc
gcgattccgtggggcttctcatggggccagtgccggctgctgctcaccggctggtacggc
ttcggcagcgcggtcgccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctgaagaaaatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcggttgcgtcgcgctacgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcatcgc
acggcggatgcgctcgccgagatcaccggcgcgcacgcgcggctcgccgcgaatccgctt
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaagtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccat
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system