KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1302Help
Entry
BMA10247_A1302    CDS       T00479                                 

Definition
(GenBank) AMP-binding domain protein
Organism
bmn  Burkholderia mallei NCTC 10247
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:complement(1275384..1277216)
Genome map
AA seq 610 aa AA seqDB search
MRRVQITDGAIVPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARS
IAAWLSACGAARRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRD
AGIALALTPTAADAHALANCLAAPGDAVSTVGALRCEATDALEALDASAWSRPALDASAI
AFLQYTSGSTGEPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLH
PLYVGCDCVFMAPSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKREQLGGLDLS
ALKVALNGAEPVRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLD
IDARALERHEASLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSV
AQGYWRRPDASEAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQ
DIEDFVRELHPALGAGAGAAFSIDADGERVVVVHEIKEAWLDDGLSAAALSARIRTALAR
AFDIAAPSVVLVPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEG
VAQDASRGAA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtgtacaaattactgatggagcaatcgtgccgtctaattttgccgaacacttc
gaaaatcaagtcttgaagtatgggaatcgcagtcaatttgtttttctacacggaaaaccc
ggtgattcggccggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcg
atcgccgcgtggctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatccc
gaaggcctcgcgtttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtg
ccggtgcccgtgcccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgcgat
gcgggcatcgcgcttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgc
ctggctgcgcccggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgac
gcgctcgaggccctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatc
gcgttcttgcaatacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcat
cgtaatctgctgcacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagc
gtcgtgacgggatggctgccgcattttcacgacatggggctgatcggcatgctgctgcat
ccgctgtacgtcggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtccc
gttcgatggctggaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttc
gcgtacgacctgtgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtcc
gcgctgaaggtcgcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttc
tcggcgcgtttcgcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatg
gccgaggtcacgttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgat
atcgacgcgcgggcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcg
ttgcgcgtcgtgggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaa
acgcacgccgtggcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtc
gcgcaaggctactggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggcc
gcaggcgacgggccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctg
ttcgtgaccgggcgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcag
gacatcgaggatttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcg
ttttcgatcgatgcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgtgg
ctcgacgatggcctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgc
gcgttcgacatcgcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacg
acgagcggcaaggtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgc
gtgctgcacgaggatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggc
gtcgcgcaggatgcctcccggggcgccgcatga

DBGET integrated database retrieval system