KEGG   Bombyx mori (domestic silkworm): 101745054Help
Entry
101745054         CDS       T02817                                 

Definition
(RefSeq) hexokinase type 2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101745054
   00051 Fructose and mannose metabolism
    101745054
   00052 Galactose metabolism
    101745054
   00500 Starch and sucrose metabolism
    101745054
   00520 Amino sugar and nucleotide sugar metabolism
    101745054
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101745054
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101745054
Membrane trafficking [BR:bmor04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101745054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 474 aa AA seqDB search
MLAAVRSTFAGICSKSKKTNSMCANDLIHSRIREECEVLKMTDKQIKEIMCRLHNDLKKG
LSRADHDKATVKCWITYIQDLPNGKERGKFLALDLGGTNFRVLIINLGENHFDMQSKIYA
IPKHIMTGTGIALFDHIAECLPNFMKEHGVYEERLALGFTFSFPLKQLGLTKGVLQRWTK
GFSCSGVVGEDVVQGLKDAIARRGDVQIDICAILNDTTGTLMSCAWKNHNCKIGLIVGTG
SNACYVEKTANCELFDGEPDKEELLINTEWGAFGDDGSLDFVRTEFDREVDVTSINPGKQ
IQEKMISGMYLGELVRLALVKFTRMGLLFGGQGSDLLFEGGSFYTKYVSEIESDKPGDFT
SCMEVLEELGLSHASDADMAAVRYVCECVSRRAAHLVSAGIATLLNKMNEPRVTVGIDGS
VYRFHPHFHTLMCEKIAQLVRPGLQFDLMLSEDGSGRGAALVAAVACREAEQGS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttggcagcggtaagaagtacgttcgcgggtatctgctcgaaatcaaagaaaaccaac
agtatgtgtgccaacgatttgattcattccaggattcgcgaagaatgcgaagtcctaaag
atgaccgacaaacaaatcaaagaaataatgtgcaggcttcataacgatttgaagaaaggg
cttagccgcgctgatcatgacaaagctacagtaaagtgctggatcacatacatacaagat
ttacccaacggaaaagagagaggtaaatttttggcattagatttaggtggaacgaatttc
agagttttaataataaatttaggggaaaaccattttgatatgcagtccaaaatctatgcc
ataccaaaacatataatgactggcaccggcattgctctatttgaccacatagccgaatgt
ttaccaaattttatgaaggagcacggagtttatgaagaaagattggcacttggatttaca
ttcagttttccactaaaacaactgggtcttacaaaaggcgtattacaaagatggactaaa
ggtttctcttgttccggtgtggtcggcgaagatgttgtacagggccttaaagatgctatc
gccagaagaggggatgtacagattgacatatgcgctattctgaatgatacaaccggtaca
ttgatgtcctgcgcatggaaaaaccacaactgcaaaataggactcatcgttggtactggc
agcaacgcttgttacgtcgagaaaacagcgaattgtgagctgttcgatggcgaacctgac
aaagaggaactgctcattaataccgagtggggggcgtttggggatgacggcagcctcgac
ttcgtgcggaccgagttcgatagagaagtagacgtcacatccataaaccctggcaaacaa
attcaagagaagatgatttctggcatgtacctgggtgaattggtgcggctggcgctcgtc
aaattcactcgaatgggcttgctgttcgggggtcaaggttcggatcttctgttcgaaggg
ggcagcttctataccaaatacgtgtctgaaattgaatccgataaacccggagacttcacc
agctgcatggaggtcttggaagaactcggtttgtctcacgcgtctgacgcggacatggcg
gcggtgcgctacgtgtgcgagtgcgtgtcgcggcgggcggcgcacctcgtgtcggcaggc
atcgcgacgctcctcaacaagatgaacgagccgagggtcaccgtgggaatcgacggctcc
gtataccgcttccatccgcacttccacacgctaatgtgtgagaagatcgctcaacttgtc
cgacccggactacagttcgatctcatgttatccgaggacggcagcgggcgtggcgcagcc
ctagtggcagcggtggcgtgccgggaagcggaacaagggtcgtag

DBGET integrated database retrieval system