KEGG   Bacillus megaterium QM B1551: BMQ_1891Help
Entry
BMQ_1891          CDS       T01208                                 

Gene name
ycbD
Definition
(GenBank) aldehyde dehydrogenase YcbD
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMQ_1891 (ycbD)
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BMQ_1891 (ycbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADE68920
UniProt: D5DPJ9
LinkDB All DBs
Position
1894868..1896334
Genome map
AA seq 488 aa AA seqDB search
MTISVQDKQYLNFINGKGVPSSSQEMMESLNPANKKEAVGYVQKSTLEDLNLAIKAAKQA
QEKWKRLSGAARGQYLHKAADIMENRLDEIAECATREMGKTLAETKGETARGIAILRYYA
GEGMRKMGDVIPSTDAEALMFTSRVPLGVVGVITPWNFPIAIPIWKIAPALVYGNTVIIK
PATETAITCAKIIECFEEAEIPAGVVNMITGSGSIIGQAIAEHPEINAITFTGSDRVGKQ
IGQQAFARGAKYQLEMGGKNPVIVAADADLDLAVEGTISGAFRSTGQKCTATSRVIVQHE
VYEKFKQKLLAKTKEITVGEGLNEDTWMGPCASENQLQTVLSYIEKGKSEGATLLYGGRQ
LTDGEYENGFYVEPTIFENVESHMTISQEEIFGPVIALMKVESIEEALALANDVQYGLSA
SIFTTNISHMLSFINEMDAGLIRINSESAGVELQAPFGGMKQSSSHSREQGEAAKEFFTA
IKTVFIKS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaattagtgttcaagacaaacaatacttaaattttattaacggaaaaggtgttcca
tcatcgtctcaagagatgatggagagtctaaacccagccaataagaaagaggctgtagga
tatgtacaaaaatcaactcttgaagatttaaatctagcgataaaagcagctaaacaagct
caagaaaaatggaagcgcttgtcaggcgcagctcgcggacagtaccttcacaaagctgcg
gatattatggaaaatagactagatgaaattgcggaatgtgctacacgtgaaatgggaaaa
accttggctgaaacaaaaggagaaacagctcgcggaatagctattcttcgatactatgca
ggggaaggtatgagaaaaatgggagatgtaattccttctaccgatgctgaagcattgatg
tttacatctcgagtaccgttaggcgttgttggagttatcaccccatggaactttcctatt
gctattcctatatggaaaatagctccggcacttgtttacggaaatactgtcataattaag
ccagctactgaaacagctattacgtgcgctaagattatcgaatgttttgaagaagcagaa
attccagcgggtgtagtaaatatgattacgggctctggatcaatcattggtcaagctatt
gctgaacatccagaaattaatgcgattacatttacaggatccgatcgagtaggcaaacaa
attggtcaacaggctttcgctcgaggagctaaatatcagttagaaatgggggggaagaac
ccggtaattgtagcggcggatgcagatttagatttagcagtagaaggtacgatcagcggt
gcattccgttccacaggtcaaaaatgtactgcgactagtcgggtaattgttcagcatgag
gtatatgaaaaattcaaacaaaaactattagcaaaaacgaaggaaattaccgttggagaa
ggattaaacgaagacacgtggatgggaccatgtgcaagcgaaaatcagttacagaccgta
ttgtcatatattgaaaaaggaaaaagtgaaggtgcaactcttttatacggaggacgtcag
ttgactgacggggaatatgaaaatggattttacgtagaacctactatttttgaaaacgta
gaatcgcatatgacgatatcacaagaagaaatttttggccccgtaatagcattgatgaaa
gtagaatccatcgaggaagcattagcactagctaacgatgttcaatatgggctaagtgct
tctattttcactacaaatatttctcatatgctttcttttattaatgaaatggatgctggg
cttattcgaattaactcggaaagcgcaggcgttgaacttcaggcaccttttggaggcatg
aaacaatcaagttctcactctagagaacaaggggaggctgctaaagaatttttcacagct
attaaaactgtttttataaaaagttaa

DBGET integrated database retrieval system