KEGG   Bacillus megaterium QM B1551: BMQ_2135Help
Entry
BMQ_2135          CDS       T01208                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bmq  Bacillus megaterium QM B1551
Brite
Enzymes [BR:bmq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BMQ_2135 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2138650..2139273
Genome map
AA seq 207 aa AA seqDB search
MVINKKKEESRMQKLIMNGCVVFVLLLLGACSMVKEQNNAHENHLKTEEAKETSEVSVEP
VKVDLTNTSGKKVGEATLSEAKNGVQIKLTAQGLSPGRHGFHIHEIGKCEVPDFKTAGAH
FNPFKREHGYKNTKGPHAGDLPNLEVAPNGKVDTEIFASLVTLQEGKPNSLLDMDGSALV
IHDKVDDYTTDPSGNSGDRIVCGVITK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtgataaataagaaaaaggaggaatcacggatgcaaaagttaataatgaacggatgt
gtagtctttgttctgttattgttaggagcatgcagcatggtaaaagagcaaaataacgct
catgaaaaccacttgaaaacagaggaagcgaaagaaacaagcgaagtatcggtagaacct
gttaaagtggatttaacgaatacatcgggcaaaaaagtaggagaggctaccctgtcagaa
gcaaagaacggcgtgcaaattaaattaactgctcaaggtctttcaccgggaagacatgga
tttcatattcatgaaataggaaaatgtgaggtgccggattttaaaacagcgggtgcccat
tttaatccttttaaacgtgaacacggttataaaaatacaaaaggcccgcatgcaggtgat
ttgcccaatctagaagttgctccaaatggcaaagtagatacagaaatttttgcttctctt
gtcacgctgcaagaaggaaagccgaattctcttttggatatggatggatcggcattagtg
atacatgataaagtcgacgattacacaacggatccttcaggaaactcaggagatcggatt
gtttgtggagtgattacaaaataa

DBGET integrated database retrieval system