KEGG   Bacillus megaterium QM B1551: BMQ_2447Help
Entry
BMQ_2447          CDS       T01208                                 

Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bmq  Bacillus megaterium QM B1551
Brite
Enzymes [BR:bmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BMQ_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2444008..2444823
Genome map
AA seq 271 aa AA seqDB search
MIKVNQQIVKISDLNNSSLTKEKADILKQMDAYREVYEYATFDQLDFDVSVKLQIIESSV
LLRKSGARFATFARSRCNEKYWKRTDNGGFQLLPTVSPHQAIDDIFYNGHEYAFECATAV
IIIFYKAVLNNIGKANFNRLFADLYLHDWQYDEDLELHGYKGSDYLPGDCAYFKNPDYNP
DTPQWKGENTIVLDETLYFGHGIGITTRERIIEVLNLKRKDDAKQSAYLSDEIVRLHTAH
LSYFAVRYEPVVWYDRNSAIISTIGSITYVA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagttaaccaacaaattgtgaaaataagtgatctaaataatagttcgttaaca
aaagaaaaagcagacattttaaaacagatggatgcctatagggaagtgtatgagtatgct
acatttgaccagcttgattttgatgtatctgttaaattacaaattattgaatcgtctgtg
ttgctgcgcaaaagcggtgccaggtttgctacatttgcacgttctaggtgtaacgaaaag
tattggaaaagaaccgataacggaggatttcagctactgcctaccgtttctcctcatcag
gccatcgatgatattttttacaacggacacgaatatgcgtttgagtgcgcgacggctgtt
atcatcatcttttacaaagctgtattaaataatattggaaaagcaaactttaacaggctt
tttgctgatctttacttacacgattggcaatatgatgaagatcttgagctccatggttat
aaaggatctgactacttgcccggagactgtgcgtattttaaaaatcctgattataaccct
gatactccccagtggaaaggtgaaaacacaattgtattagatgaaactctatattttggt
catggaattggaattacgacccgggaaagaattattgaagtgttaaatttaaagagaaaa
gacgacgcaaagcaatcagcttacctgtcagatgaaattgtcaggcttcacaccgctcac
ctcagttattttgcagttagatacgaacccgttgtttggtacgacagaaacagcgctatt
atttccactattgggtcgattacgtatgtagcttga

DBGET integrated database retrieval system