KEGG   Brucella suis 1330: BR1076Help
Entry
BR1076            CDS       T00096                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bms  Brucella suis 1330
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bms00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BR1076 (hisI)
Enzymes [BR:bms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BR1076 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:1046358..1046717
Genome map
AA seq 119 aa AA seqDB search
MPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETGIAHYWSRSRKTLWKKGETSG
NLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYRQVVSSGGKVALTMVSDHDQ
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggtaagcgatcacgatcaataa

DBGET integrated database retrieval system