KEGG   Brucella suis ATCC 23445: BSUIS_B0344Help
Entry
BSUIS_B0344       CDS       T00638                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bmt  Brucella suis ATCC 23445
Pathway
bmt00250  Alanine, aspartate and glutamate metabolism
bmt00410  beta-Alanine metabolism
bmt00430  Taurine and hypotaurine metabolism
bmt00650  Butanoate metabolism
bmt01100  Metabolic pathways
bmt01110  Biosynthesis of secondary metabolites
bmt01120  Microbial metabolism in diverse environments
bmt02024  Quorum sensing
Module
bmt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BSUIS_B0344
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSUIS_B0344
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSUIS_B0344
   00430 Taurine and hypotaurine metabolism
    BSUIS_B0344
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BSUIS_B0344
Enzymes [BR:bmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSUIS_B0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABY39350
UniProt: A9WY34
LinkDB All DBs
Position
II:319471..320835
Genome map
AA seq 454 aa AA seqDB search
MIASVFGTEALQEIAASRGFREKEMQANAVYQIIHDELFLDGNARQNLATFCQTWDDDYV
HKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWNAPKFADNATGTNTIGSSEACMLG
GMAMKWRWRKKMQEMGKPTDKPNFVCGPVQVCWHKFARYWDVEIREIPMEPGRLFMGPEQ
MLEAVDENTIGVVPTFGVTYTGNYEFPEPLQDALDKLQKTKGLDIDIHVDAASGGFLAPF
CAPDIPWDFRLPRVKSISASGHKYGLAPLGCGWVVWRDKEALPEELIFNVDYLGGQVGTF
AINFSRPAGQVISQYYEFMRLGREGYTKVQQAAYRVAQYIAREIEPLGPYEFICAGEEKG
GIPAVCFRIREGEDPGYSLYDLSERLRLTGWQVPAFALSGKASDITVMRVMCRRGFEMDL
AALFIRDFKAGIEFFKSHPSPKITPSMGTGFHHT
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ttgattgcctctgtttttggcaccgaggctttacaggaaattgctgcttcgcgtggtttt
cgcgaaaaggaaatgcaggcgaacgctgtttaccagattattcatgacgaactgtttctc
gatggtaatgcccgtcagaatctggcgaccttctgtcagacatgggatgatgattacgtc
cacaagctgatggacctttcgatcaacaagaactggatcgacaaggaggaatatccccag
tcggcggccattgatctgcgctgtgtcaacatggtcgcggacctctggaatgcacccaaa
ttcgccgataatgccacaggcaccaatacgatcgggtccagcgaggcctgtatgcttggt
ggtatggccatgaaatggcgctggcgcaagaagatgcaggaaatgggcaagccgacggac
aagcccaatttcgtttgtggcccggtgcaggtgtgttggcacaaattcgcccggtactgg
gatgtcgagatccgggaaattccgatggagcctggccgcctgttcatgggaccagaacaa
atgcttgaagccgttgatgaaaataccatcggcgtcgtgcccactttcggcgtgacctat
accggcaattatgaatttcccgaaccgttgcaggatgcgctggacaagctgcaaaagacc
aagggtcttgatatcgatatccatgtcgatgcggcaagcggcggctttctggcaccattt
tgcgcgcccgatattccgtgggatttccgcctgccgcgcgtgaagtcgatcagcgcgtca
ggccataaatacggtctcgcaccgcttggctgtggctgggttgtctggcgcgacaaagag
gccctgccggaagagctgatcttcaatgtggattatctcggtggacaggttggcactttc
gcaatcaatttctcgcggcctgccggtcaggtcatttcacaatattacgaattcatgcgt
cttggccgcgaaggctacaccaaggtgcagcaggcggcctaccgcgtggcgcaatatata
gccagggagatcgagccgcttgggccttatgaattcatctgcgcgggcgaggagaaaggc
ggcattcccgccgtctgtttccgcatccgtgaaggcgaagaccccggttattcgctctat
gatctgtcggaacggctgcgtctgaccggatggcaggttcccgctttcgctctttcgggc
aaggcgtcggatatcactgtcatgcgcgtcatgtgccgccgcggtttcgagatggatctg
gctgcactcttcattcgggatttcaaggctgggatcgagttcttcaaatcgcatccttca
ccgaagattaccccgtcgatgggaaccggctttcaccacacataa

DBGET integrated database retrieval system