KEGG   Burkholderia multivorans ATCC BAA-247: NP80_2570Help
Entry
NP80_2570         CDS       T03881                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bmul00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NP80_2570
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NP80_2570
   00680 Methane metabolism
    NP80_2570
Enzymes [BR:bmul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NP80_2570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:2737409..2740423
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSVRATRRNAALPSSDAPTSAVATAANGRAKPATKPKDPIRRTKRAATTRTASART
AATPKSGGRTREDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
REAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AHALDKLKTTGNASKRVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQHNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLEELPALYGDIE
AALAEHGLAARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRATPYADSDEFVADLKVLTASLAEHHGASLAAPRLTPLMRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVVADYASLEEADKLRVLLAALADPRPLRSPYIEYSA
LAQSELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGALGAPDG
HAKNALMVIPLFETIPDLRDASRIMREYFALPGVDALIHHQGDEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVELFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEGAMQTLSDTAMAA
YRALVYETPGFTDYFFASTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVATYLDGAADEAERSKRLALLKKMNKTWPFFANLLSNMDMVLAKTD
LAVASRYAELVPDRKLRNAVFGRIVAEWERTSHALAEITGHEERLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggtgcgcgcgacgcgccgcaatgctgccctgccctcctccgac
gccccgacgagcgccgtcgccaccgccgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagacccgatacgtcggacaaaacgtgcggccacgacgcgcacggcgagcgcgcgcacg
gcagcaacgccgaagtcgggcgggcgcacgcgcgaagacaaggatcgtccgctgttcgaa
gacatccgtttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacacg
gtgttcgacgtcgtcgagacgattcgtcagaccgcggtcaagttccgccgcgaggacgac
cgcgaagccgcgcagacgctcgagaagaagctgcgcaagctgacgcccgagcagacggtc
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggatcgccac
cacaaccgccgccgccgcatccacgcgctcgcgggctcggcgccgcagccgggcacggtc
gcgcacgcgctcgacaagctgaagacgaccggcaatgcatcgaagcgcgtgctgcagcgc
ttcttcgacgacgcgctgatcgtgccggtactgaccgcgcacccgaccgaggtgcagcgc
aagagcattctcgacgcgcagcacgacatcgcccggctgctcgccgaacgcgatcaggaa
ctgaccgcgcgcgagcgccagcacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcggatgctgcgcgacgcgcgcctgacggtcggcgacgaaatcgagaacgcg
ctgtcctactaccgcgcgacgttcctcgaggaattgcccgcgctgtacggcgacatcgag
gccgcgctcgcggagcacgggctggcggcgcgcgtgccggcgttctttcagatgggcagc
tggatcggcggagatcgcgacggcaatccgaacgtgacggccgcaacgctcgacgaagcg
atcaatcgccaggcggcggtgatcctcgagcactatctcgagcaggtgcacaagctcggc
gccgagttgtcggtgtcgaacctgctggtcggcgcgaacgacgcggtgaaagcgctcgcg
gccgcgtcgcccgaccagtcgccgcaccgcgtcgacgagccgtaccggcgcgcgctgatc
ggcatctacacgcgccttgccgcaagtgcgcgcgtgcggctcggcgaaggcacggtgccc
gtgcgcagcgcagggcgcggcgccccgcccgtgcgcgcaacgccgtatgcggattccgac
gaattcgtcgcggacctgaaggtactgaccgcatcgctcgccgaacatcacggcgcgtcg
ctcgccgcgccgcgcctcacgccgctcatgcgcgcggccgaagtgttcggcttccacctc
gcgagcatcgacctgcgccagagctccgacattcacgaagcggtggtcgcggagctgttc
gcgcgcgcgggtgtcgtggccgactacgcgtcgctcgaagaggcggacaagctgcgcgtg
ctgctcgccgcgctggccgatccgcgtccgctgcgctcgccgtacatcgaatactcggcg
ctcgcgcaaagcgagctcggcgtgttcgaaaaggcccgcgaagtgcgtgcgcagttcggc
gcgcgcgcggtgcgcaactacatcatttcgcacacggaaacggtcagcgatctcgtcgag
gtgctgctgctgcagaaggagaccggcctgctcgaaggcgcactcggcgcgccggacggc
catgcgaagaatgcgctgatggtgatcccgctgttcgagacgattcccgacctgcgcgac
gcgtcgcggatcatgcgcgagtatttcgcgctgccgggcgtcgatgcgttgatccaccat
cagggcgacgagcaggaagtcatgctcggctactcggacagcaacaaggacggcggcttc
ctgacgtcgaactgggagctgtatcgcgccgagctcgcgctcgtcgaactgttccgcgag
cgcaagatcacgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggc
ccgacctatcaggcgatcctctcgcagccgccgggcaccgtaaacggccagatccgcctg
accgaacagggcgaagtgattgcgagcaagttcgcgaaccccgagatcggccggcgcaac
ctcgagacggtcgtcgcagcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgcct
gcgcagctgccggcgttcgagggcgcgatgcagacgctgtccgacaccgcgatggccgcg
taccgcgcgctcgtctacgaaacgccgggcttcaccgactacttcttcgcgtcgacgccg
atcaccgaaatcgccgagctcaacatcggcagccgcccggcgtcgcgcaagctgcaggat
ccgaagaaccgcaggatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgaccggctggtacggcttcggcagcgcggtcgccacgtatctggac
ggcgcggccgacgaagcggaacgcagcaagcggcttgcgttgctgaagaagatgaacaag
acctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgccgtcgcgtcgcgctacgcggaacttgtgccggaccgcaagctgcgcaacgcggtg
ttcggacgcatcgtcgccgagtgggagcgcacgtcgcacgcgctcgcggagatcaccgga
cacgaggaacggctcgcgacgaatccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctcgatccgctgaatcacctgcaggtcgaactgatcaagcgccaccgcgccggcgac
acgaacgcgcggctgcgccgcgggattcatctgacgatcaacgggatcgcggccgggctg
cgcaatacgggctga

DBGET integrated database retrieval system