KEGG   Burkholderia multivorans ATCC BAA-247: NP80_3938Help
Entry
NP80_3938         CDS       T03881                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmul00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NP80_3938
Enzymes [BR:bmul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NP80_3938
Transporters [BR:bmul02000]
 Other Transporters
  Pores ion channels [TC:1]
   NP80_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(825415..826140)
Genome map
AA seq 241 aa AA seqDB search
MRYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVSAMMRMMDSTKAECVPFA
PPFLKAGDIVIGQTANILLFLGTRLGLAPDDEAGRLWVHQLQLTIADFVTEIHDTHHPIG
SGLYYEDQKAEAAERSADFLAHRLPKFLGYFERVLAQNPHKSGYLAGNALSYADLSTFQL
IEGLRYAFPKAMKREEKKIAGLVALRDRVEQHPPIARYLASERRIPFNDMGIFRHYPELD
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatgaactctattactggcccgagatccagggccgaggcgaatatgtgcggctc
gcgctcgaagcggccgaagcggactacgtcgacgtcgcgcgcgagtcggggcgcggcatg
ggcgtgtcggccatgatgcggatgatggacagcacgaaggccgaatgcgtgccgttcgcg
ccgccgtttctgaaagccggcgacatcgtgatcgggcagacggcgaacattctgctgttt
ctcggcacgcggctcggcctcgcgcccgacgacgaagcgggacggttgtgggtgcatcag
ctgcagttgaccatcgccgacttcgtcaccgagattcacgatacgcaccacccgatcggc
agcggtctgtactacgaggatcagaaagcggaagccgccgagcgctcggccgatttcctc
gcgcatcgcctgccgaagtttctcggttacttcgagcgcgtactcgcgcagaatccgcac
aagagcggctacctcgccggcaacgcgctcagctatgcggatctgtcgacgttccagctg
atcgaagggctgcgttatgcgttcccgaaggcgatgaagcgcgaggagaaaaagatcgca
gggctcgtcgccctgcgcgatcgcgtcgagcagcatccgccgattgcgcgctatctcgcg
tcggaacgccgcatccccttcaacgacatggggatcttccgccactaccccgagctggac
gcgtag

DBGET integrated database retrieval system