KEGG   Burkholderia multivorans ATCC BAA-247: NP80_4148Help
Entry
NP80_4148         CDS       T03881                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
bmul00440  Phosphonate and phosphinate metabolism
bmul01100  Metabolic pathways
bmul01120  Microbial metabolism in diverse environments
bmul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmul00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    NP80_4148 (aepX)
Enzymes [BR:bmul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     NP80_4148 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AJY15412
LinkDB All DBs
Position
2:complement(1079439..1081127)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSDELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAVVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPTNQSVRDFAFCSAADDRGLFGQKVLLQRVSSDAAAGTPHGRWIGLLNV
RGAGVERLKAMLATLQARADFDTLDIPALLNALIDAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcgacgagctcgaatttctgatggaagcccacaacggcctgtccgcacgcatcgtg
cgcgaagccggcttcaagggcatctgggcgtccggcctcgcgatctccgcgcagttcggc
gtacgcgacaacaacgaggcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcaaagcgaccccgacttctcg
atcgtcgcgcgcgtcgaagcgctgatcgcgggctggggcatggacgaggcgctgcgccgc
gcgaacgcctatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgt
cccgacgaaatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtcggcgtcggcgatgcaggccgtcgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgtctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgcggcggtcgtgctcgccgcgagccgcggcaaggggctcgaagcc
gtcaccgaggacaagccgaaggtgatgctgcccgttgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcacggtggtcggcggctatcgc
gccgatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccacgccgaaacg
ggcgagctcgcatcgctcgcctgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctcctgttccgcagctacatcctgcgcgatctcgcggaaagcgaggccgag
ttcagcgttgtcgtcgattcgtcgctgaccgagccgaccaaccagagcgtgcgcgacttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaggtgctactccagcgc
gtgtcgagcgatgccgccgccggcacgccgcacggccgctggatcgggctgctgaacgtg
cgcggcgccggcgtcgagcgcctgaaggcgatgctcgcgacgctgcaggcacgcgccgat
ttcgacacgctcgacatccccgcgctgctcaacgcgctgatcgacgccggcgagaaaatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgc
gcgggcgacttcgcgcatggacaaacgccgctgtccgaaccgggcgccggcaacggaggc
gcgcaatga

DBGET integrated database retrieval system