KEGG   Brugia malayi (filaria): Bm1_04175Help
Entry
Bm1_04175         CDS       T01050                                 

Definition
(RefSeq) Histone deacetylase family protein
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Bm1_04175
Chromosome [BR:bmy03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Bm1_04175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 600 aa AA seqDB search
MENQQQSYTTATVEGPSTAPFGIASDAIDEERLAVLQQIYQQKQVELLSQYQQAQTNLAM
QHFTYFQALQTSQQQKQQQQQQQQQQKQSLHDTKTSEQTSSISTLDISEDSDTQVSPSTK
DCAGLRNKRSYSGSGQTISQLTKERLKTMITSKMNRIRSESSNVSQATTTVWTTSAASST
TNFGSQQMHTASSVQTPIALSSLHFEPYYIPSTMHAVHGTLQPSDYQLRKVWYMILNSTP
NNSLVYDPAMARHQCFCGNNRNHVEHGERVQSIWSRLQERGLVEKCERVFARKAPLEMLR
TVHAATYVTFFAVSPTACLKMEPSQLPVKSFVQLSCGGIGVDSDTYFNDASTQLAARIAV
GSLAELALQRCAEQCSRIAIIDWDVHHGNGTQICFEADPSVLYLSLHRHDNGNFFPGTGA
VTEVGVGSGKGYTVNIPFSGEMMDDADYLAAWRVIVAPILNQFKPTFIIVSAGFDAACGH
PQALGGYNLSPQLFGYFTLQLMNYAGGRVVLALEGGYDLDTISDSAEECVKALCGESPET
AGKLSDEALNAFPKQSAQETIQKVIAIHKKYWPSLTAAQGISSSELQWQAVAQKFASLSV
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaacagcagtcctatacgacagcaacagtagaaggtccttcaacagcaccg
ttcggaatagcatcagatgcaatcgacgaagaacgattagccgtccttcaacagatttat
caacaaaagcaagtagaactcttgtcacaatatcagcaagcacaaacaaaccttgccatg
caacactttacttactttcaagctcttcaaacatctcaacaacaaaagcagcagcagcaa
caacaacaacagcaacagaagcaatctttgcatgacaccaaaacttcagaacaaacaagt
tccataagcactctggatatttcagaggatagtgatacacaggtgtcaccttccactaaa
gattgtgcaggattgagaaataaaagatcctattctggttccggacaaacaatttctcag
ctaacaaaggaacgtttaaaaacaatgattactagtaaaatgaatcgtattcgctctgaa
agtagcaatgtatcacaagcaacaacaacagtttggacgacatctgctgcatcaagcact
acaaatttcggctcacaacaaatgcatactgcatcttcagtacaaacaccgattgcactt
tcatcactgcattttgaaccgtattacattccttcaacaatgcatgcggtgcacggaacg
ttacaaccatcggattatcaattacgtaaagtttggtatatgatcttaaatagcactcct
aacaacagtttggtatatgatcctgcaatggcaaggcatcagtgtttctgtggtaataac
aggaatcacgtggaacacggtgaacgtgtgcaatcaatttggtcacgattacaggaacgt
ggtttggttgaaaagtgtgaacgagtatttgctcgtaaagcgccattggaaatgttgaga
accgttcatgctgcaacatatgttaccttctttgctgtatcgccaacggcttgcctcaag
atggaaccatcacagttgcctgtaaaaagttttgtacaactttcttgtggtggtattgga
gtcgattcggatacatatttcaacgatgcttcaacacaattagcagcacgtattgctgtt
ggttctttagctgaactagcactgcagcgatgtgccgaacagtgttcacgaatagcaata
attgattgggatgttcatcatggcaatggtacgcaaatttgctttgaagctgatccttcg
gtgctatatttatctcttcatcgtcatgataatggcaatttttttccgggtacaggagct
gttacagaggtaggtgttggatcgggtaaaggttatacggtgaatataccattttcgggt
gaaatgatggatgatgctgactatttagcggcatggcgtgttattgttgcgcctatatta
aatcaatttaaaccaacatttattattgtttcagctggctttgatgccgcatgtggacat
cctcaggctcttggaggctataatttatcaccacagctgtttggttattttacgctccag
cttatgaattacgctggtggacgtgttgtacttgctttggaaggtggttacgatcttgat
actatatcagattcagctgaagaatgtgttaaggcattatgtggtgaaagtcctgagaca
gccggcaaattaagtgatgaagctttgaatgcatttcctaaacaaagtgcacaggaaaca
atacaaaaggtaatcgctattcataaaaagtattggccatcgctaacagcagcacagggc
attagtagcagtgaacttcagtggcaagcagtggcacaaaaatttgcttcactgtctgtt
tga

DBGET integrated database retrieval system