KEGG   Brugia malayi (filaria): Bm1_41805Help
Entry
Bm1_41805         CDS       T01050                                 

Definition
(RefSeq) Hexokinase family protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_41805
   00051 Fructose and mannose metabolism
    Bm1_41805
   00052 Galactose metabolism
    Bm1_41805
   00500 Starch and sucrose metabolism
    Bm1_41805
   00520 Amino sugar and nucleotide sugar metabolism
    Bm1_41805
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bm1_41805
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Bm1_41805
Membrane trafficking [BR:bmy04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Bm1_41805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 498 aa AA seqDB search
MLLELASSFANRFANKGYGIFESGDERLPINDRDLENRRKIDEICRSLMLNDDDLKRVMD
ELLKAMEKGLDRKTASQAAVKMLPSFVRAVPNGTEVGNFLALDLGGTNFRVLLIKLNKRD
AHMAGTIFRVPESIMRGTGEGLFDHIAECMARFMEEKDIKQAGKLPLGFTFSFPCRQEGL
TCAKLINWTKGFSASNVEDKDVVTLLREACQRRKDIDIDVVAVLNDTVGTLMACAFKENT
CQIGVIVGTGSNACYMEKIANCDKIKDLHLEEDGMPDEMIINTEWGAFGDDGALEFVRTC
FDREVDEKTINPGKQLFEKMISGMYMGEIVRVILAHLARQNLLFNGDYEAISKPHSFPTK
YVSEVEKEILEDEERNFAKTMQILEEIGTEQVSVADCINVAYVCSLVSTRAAYLCAAGIA
TLLNRMQKPYVTVGVDGSVYRFHPTFPRLLDEKIEQLIDKNLKYQLMLSEDGSGRGAALV
AAVATRIKNKCCSQTSTN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggaattagctagttcatttgccaatcgatttgcaaataaaggatatggtatt
tttgaaagtggtgatgaaagacttcctattaatgatcgtgatttggagaatcgacgtaaa
attgatgaaatctgtcgttctctcatgctcaatgatgatgatttaaaacgtgtgatggat
gaattgcttaaagcgatggaaaagggcctagatcgcaaaactgcgtcacaggcagcagtg
aaaatgttgccttcgtttgttcgtgcagtaccgaatggcactgaagttggaaattttctt
gcgcttgaccttggcggtaccaattttcgtgtgctgttgattaagttgaataaacgagat
gcccatatggctggaacaattttccgtgtaccagaaagtataatgcgtggcactggtgaa
gggctgttcgatcatatcgctgagtgcatggctcgtttcatggaagaaaaagacatcaag
caggctggaaagcttccgcttggtttcacattttcatttccatgtcgacaagaaggtctg
acatgtgcgaaattgatcaattggaccaaaggcttcagtgcgagtaacgtcgaagataag
gacgtcgttacgctgttacgtgaagcatgccaacgccgcaaggatattgacatcgatgtg
gtagctgttctaaatgatacagttggtacgttaatggcttgtgcattcaaagagaataca
tgtcaaattggtgttatcgttggtacaggcagtaatgcatgctacatggaaaaaattgcg
aattgtgataaaattaaagacttgcatctagaagaagatggaatgccagatgagatgatc
atcaatactgaatggggtgcttttggcgatgatggtgccctggaattcgtgcgtacctgt
ttcgatcgagaagtggacgagaaaacgatcaatcctggcaaacaactattcgaaaaaatg
atctcgggtatgtacatgggcgaaatagttcgcgtcattctagctcacctggcacgccag
aatcttcttttcaatggcgattacgaggctatttcaaagccacattcattcccgactaaa
tatgtctctgaagttgaaaaagaaattttggaagatgaagagcgaaactttgcaaaaaca
atgcaaattttagaagaaattggaactgaacaagtatcagtcgctgactgtattaatgtt
gcatatgtgtgctctcttgttagtacaagagctgcatatctgtgtgctgctggcatagca
acattgctgaaccgaatgcaaaaaccgtacgtgacagttggtgttgacggttctgtgtac
cgatttcatcctacgttcccgcgtttgcttgatgagaaaatagagcaattgatcgacaag
aatttgaagtatcagttaatgctctccgaagatggaagcggtcgtggagcggcgctagta
gcagcagttgcaacgcgaatcaaaaataaatgttgttctcaaacatctaccaattga

DBGET integrated database retrieval system