KEGG   Brugia malayi (filaria): Bm1_54320Help
Entry
Bm1_54320         CDS       T01050                                 

Definition
(RefSeq) elongation factor Tu homologue precursor
  KO
K02358  elongation factor Tu
Organism
bmy  Brugia malayi (filaria)
Brite
Translation factors [BR:bmy03012]
 Eukaryotic Type
  Elongation factors
   Bm1_54320
 Prokaryotic Type
   Bm1_54320
Mitochondrial biogenesis [BR:bmy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bm1_54320
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bm1_54320
  Exosomal proteins of breast cancer cells
   Bm1_54320
  Exosomal proteins of colorectal cancer cells
   Bm1_54320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 6105747
NCBI-ProteinID: XP_001902322
UniProt: A0A0K0IYR7
LinkDB All DBs
AA seq 502 aa AA seqDB search
MLVYSACHRSMLASPKMVNAAGGFRENFLTKLAQLKHARCLAVPGAKQVYKRTKPHLNVG
TIGHVDHGKTTLSSAITKVLATKKGAKYRKYDEIDNAPEEKARGITINAFHLEYETEKRH
YAHIDCPGHADYIKNMITGTAQMEGAILVVAATDGAMPQTREHLLLARQVGIPLENIVVY
LNKIDEVPDKETHELVEMEMRELLSELSYPSDSPVVFGSALCALEGKNPEIGEESIWKLL
DVLDNSFIIPERHQNTEVMFPAEHVYAIKGRGTVITGKLERGSLKRGDKVELVGGGKEPV
KSVVSSLETFKKSLDVAEPGDQLGVLLRGVESKAVRRGSVLLPQGHKHVPTDKVEAQLYI
LKPEEGGAKTPVANYFTEHLFSLTWDCGVIIKIKGKDFIMPGEVGEVELYMNTVQFIEPQ
QRFTIRKDPVTIGTGVFTKLHPPRTEAEKDKKTMRMAMKAEMERLGFNPYGEQMEKRLKP
DYSNSPKQDMSVSKLFEESAQK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgtactcagcatgtcatcgatctatgctagcaagccccaagatggtaaatgct
gcaggaggttttcgtgagaattttctgacgaaattagcccaactaaaacatgcccgatgc
cttgctgttccgggagcaaagcaagtgtacaagaggacaaagcctcatctcaatgttggt
accattggacacgtggaccacggcaaaacaacactctcttcggctattactaaagttctg
gcgacaaaaaaaggcgcaaaatatagaaagtacgatgaaatcgacaatgcacctgaggaa
aaagctcgtggcataactattaatgcattccatttggaatacgaaacagagaaacggcat
tacgctcacatcgattgtccaggtcatgcagattatatcaaaaatatgattacgggaact
gcccaaatggaaggcgccattttagtggtagctgccactgatggagctatgccacagact
cgggaacatttattgttggctcgacaagttggtattcctctggaaaatattgttgtatat
ctgaataaaatagacgaagtgccggacaaagaaacacacgaattagttgaaatggagatg
cgtgaacttctttcggaactcagttatccatctgattcaccggttgtttttggttcagcg
ctttgtgctttagaaggaaagaatccagaaataggggaagaatcaatctggaaacttcta
gatgttcttgacaactcattcattattccagaacgccatcagaatacagaagttatgttc
ccggccgaacatgtttatgcaatcaaaggccgtggtactgttataactggcaaactggaa
agaggttcgttgaaaagaggagacaaagtggaattagttggtggaggaaaagaaccggtc
aagtcggtagtttccagtcttgaaacattcaagaaatcgctagacgtggcggaacctggt
gaccagcttggagttttactgagaggtgtggaaagtaaagcggtacgacgtggcagcgta
cttctaccccaagggcataaacatgttcctactgataaagtagaagctcagttgtacata
ctgaaaccagaagaaggaggtgcgaagacaccagttgcaaactatttcacggaacatcta
ttttcgctaacgtgggattgcggagtaataatcaaaatcaaaggcaaagacttcatcatg
cccggagaagttggagaggttgagttgtatatgaatacagttcagtttatcgaaccacaa
caaaggtttacaattcgtaaggatccagttacaattggaactggcgtttttactaaactc
catccaccacgaacagaagctgaaaaagataagaagactatgagaatggcgatgaaggct
gaaatggaacgacttggcttcaatccatatggtgagcaaatggagaaaaggttgaaacct
gattattcgaacagtcccaagcaggatatgtcagtttcaaaactttttgaagaaagtgca
cagaaataa

DBGET integrated database retrieval system