KEGG   Bacillus mycoides 219298: DJ92_1379Help
Entry
DJ92_1379         CDS       T03239                                 

Gene name
sodA1
Definition
(GenBank) superoxide dismutase [Mn] 1
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bmyc  Bacillus mycoides 219298
Brite
Enzymes [BR:bmyc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DJ92_1379 (sodA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1292965..1293576)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSSNGGGQPVGELAAAIEAKFGSFDAFKTEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLHYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacatgaattaccaaatttaccttatgcgtatgatgctttagaacctcacttt
gataaagaaacaatgaacatccatcatacaaaacaccacaacacttacgtaacaaattta
aacgctgcgctagaaggtcatgcagaactagctgacaaaagtgttgaagaattagttgca
aacttaaatgaagtaccagaagcaattcgtactgcagtacgcaataacggtggcggacat
gcgaatcatactttcttctggacaattctatcttcaaatggtggtggacaaccagtaggt
gaacttgcagctgcaattgaagcgaaattcggtagctttgatgcattcaaaacagaattc
gcaaaagctggtgcaactcgcttcggttctggttgggcttggttagtagtaaacaatggt
gagctagaagtaacaagcactccaaaccaagattcacctttaacagaaggtaaaactcca
gttatcggtttagatgtttgggagcatgcttactacttacattaccaaaaccgtcgtcct
gactacatcggtgcattctggaacgttgtagactggaacgcagctgaaaaacgttaccaa
gaagctaaataa

DBGET integrated database retrieval system