KEGG   Bacillus mycoides ATCC 6462: BG05_2515Help
Entry
BG05_2515         CDS       T03798                                 

Gene name
amyS
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BG05_2515 (amyS)
Enzymes [BR:bmyo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BG05_2515 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2412569..2414110
Genome map
AA seq 513 aa AA seqDB search
MLKRITVVCLLFILLFPNIYEGNKAEAATVNNGTLMQYFEWYAPNDGNHWNRLRSDAESL
AHKGITSVWIPPAYKGTSQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHK
QNIDVYGDVVMNHKGGADYTETVTAVEVDRNNRNIEVSGDYQISAWTGFNFPGRGDAYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGVDKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHARQQTGKEMFTVAEYWQNDVQAL
NNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILNGTVMKNHPALAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTA
RKNFAYGTQRDYLDHPDVIGWTREGDGVHANSGLATLLSDGPGGSKWMDVGKNNAGEVWY
DITGNQTNTVTINKDGWGQFYVSGGSVSIYVQR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaggattacggtagtctgtttattgtttattttgctttttcctaatatatat
gagggaaataaggcagaagcagcaacagtgaacaatggaacattaatgcagtattttgag
tggtacgctccgaatgatgggaatcattggaatcgtttgcgttccgatgctgaaagttta
gctcataaaggaatcacatctgtatggataccacctgcatataaagggacttcgcaaaat
gatgtagggtatggggcctatgatttatatgatttaggggagttcaatcaaaaaggaacg
gtgcggacgaaatatgggacaaaagcacagttgaaatctgcaattgacgctttacataag
caaaacatcgacgtatacggtgatgtagttatgaatcataaaggtggggctgattatact
gaaaccgtaacagctgttgaggtagaccgtaacaatcgaaatattgaagtatcaggtgat
tatcaaattagtgcatggacggggtttaattttccagggcgcggagatgcttattctaat
ttcaaatggaaatggtatcattttgacggaacggattgggatgaaggaaggaaattaaat
cgaatttataaatttaggggtgtagataaagcgtgggattgggaagtgtctagcgaaaat
ggaaattatgattatttgatgtatgcagatcttgattttgatcatcctgatgttgcgaat
gagatgaaaaattggggaacatggtatgcgaatgaattaaatttagatggctttcgtttg
gacgctgttaaacatattgatcatgaatatttacgcgattgggtaaatcatgccagacag
caaacggggaaagaaatgtttacagtagctgaatattggcaaaatgatgttcaggcttta
aacaattatttagcgaaagtcaattataatcaatctgtgtttgatgcaccgcttcattac
aattttcattatgcttcaacaggaaatgggaattatgatatgagaaatattttaaatgga
acagtaatgaaaaatcaccctgcactcgcagttactctcgttgagaatcatgattctcag
cctgggcagtcattggaatctgtagtaagtccgtggtttaagccgctggcatatgcattt
attttaactcgtgcagagggctatccttcagttttctatggtgattactatgggacaagc
ggaaatagtagttatgaaattccagcgttaaaagataaaattgatccaattttgacggca
cgaaaaaactttgcatatggtacgcagcgtgattatttagaccatccagatgtgattggc
tggacaagagaaggcgatggtgtacatgctaattctggtttagcgacattactctcggac
ggaccaggaggatcaaagtggatggatgttggaaagaataacgctggggaagtatggtac
gatattacgggtaatcaaacaaatactgtaacaattaataaggacggatgggggcagttc
tatgtaagtggcggctcagtttccatatatgttcagcggtaa

DBGET integrated database retrieval system