KEGG   Brassica napus (rape): 106357578Help
Entry
106357578         CDS       T04128                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106357578
   00051 Fructose and mannose metabolism
    106357578
   00052 Galactose metabolism
    106357578
   00500 Starch and sucrose metabolism
    106357578
   00520 Amino sugar and nucleotide sugar metabolism
    106357578
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106357578
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106357578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 499 aa AA seqDB search
MGKVAVGATVVCAAAVCAASVYIVRRRMQSSGKWARVIEILRVLEEDCATPIGKLRQVAD
AMTVEMHAGLASEGGSKLKVLISYVDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKQGR
VVKQEAKEVSIPPHLMTSGSDELFNFIAEALANFVATEGEDFHLPEGRQRELGFTFSFPV
KQTSLSSGTLIKWTKGFSIEDTVGQDVVGALVKAMERVGLDMNVTALVNDTVGTLAGGRY
YNPDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
LLDFDSLNPGEQILEKIISGMYLGEILRRVLLKMADEAAFFGDSVPPKLRIPFIIRTPNM
SAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRKVVVSLCDIIACRGARLSAAGIYGILKK
LGRDAPKDGETQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASDSVEVIHSNDGSGV
GAALLAASHSQYLDDSQTS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtggctgttggtgcgacggtcgtgtgcgctgcggcggtttgcgcggcgtct
gtgtacatcgtgcggcggcggatgcaaagctccgggaaatgggcgcgtgtgatagagatc
ctgagggttctcgaggaggattgcgcgacgccaatcgggaaactgagacaagtggcggat
gcgatgacggttgagatgcacgcgggtctcgcttccgaaggtggaagcaagcttaaggtg
cttatcagctacgtcgataatcttccttctggggaagaacatggtttcttttatgcgctg
gacctaggaggaacgaacttccgtgtgatgcgtgtgcttcttggtggcaaacaaggccgt
gttgtcaaacaagaagccaaagaagtctctattcctcctcatttgatgaccagcggttcg
gatgagctgttcaattttatcgctgaagcgcttgcaaatttcgtggctacagaaggagag
gactttcatctcccagagggtagacaaagggagctaggtttcactttctcgtttccggtt
aagcagacatctttgtcttctggcactctcatcaagtggaccaaaggcttctccatcgaa
gatacagttggacaagatgtggttggtgcgcttgttaaagctatggaaagagttgggctt
gacatgaatgtcacagcccttgttaatgataccgttggaacacttgctggtggtagatac
tataaccctgatgttgtcgccgctgttattctaggcactggcacaaacgcagcttatgtt
gaacgtgcacatgccattcccaaatggcacggcttacttcccaaatctggagaaatggtg
atcaacatggagtggggaaacttcaggtcatcacatcttccattgacggagtacgaccac
ttgctggatttcgatagtctgaatcctggtgaacagattcttgagaaaatcatttctggt
atgtatttgggagagatcttgcgtagagtccttctgaaaatggctgacgaggctgctttc
tttggcgactctgtcccacctaagctgagaataccattcataataaggacaccaaacatg
tctgctatgcacagcgacacttctccggatttgaaggttgttggaagcaagttaaaggac
atattggaggtccctaccacttctctgaagatgagaaaagttgtggtcagtctgtgtgac
atcatagcttgccgcggagctcgtctatcagctgcagggatctacggaatcctcaagaaa
ctaggaagagacgcaccgaaagacggagagacgcagaaatctgtgatagccatggacggt
ggactgtttgagcactacactcagttcagcgagtgtatggagagctcgttgaaagagttg
cttggagatgaagcatcagacagcgtggaggtgattcattcgaatgatggatctggcgtt
ggagctgcattactcgctgcctcgcactctcagtacctcgatgactctcaaacaagttaa

DBGET integrated database retrieval system