KEGG   Brassica napus (rape): 106429432Help
Entry
106429432         CDS       T04128                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain F1, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bna  Brassica napus (rape)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106429432
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106429432
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     106429432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 181 aa AA seqDB search
MASSMLSSAAVVTSPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWP
PVGKKKFETLSYLPDLTEVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTG
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctttcctccgctgctgtggttacctcaccggctcaagccaccatg
gtcgctccattcaccggcttgaagtcatccgctgcattcccagtcacccgcaaagcaaac
aacgacattacttccattgcaagcaacggaggaagagttagctgcatgaaggtgtggcca
ccagttggaaagaagaagtttgagaccctctcttaccttcctgaccttaccgaagttgaa
ttgggtaaggaagttgactaccttctccgcaacaagtggattccttgtgttgaattcgag
ttggagcatggatttgtgtaccgtgagcacggaagcacacccggatactacgatggccgt
tactggacaatgtggaagcttcccttgttcggatgcactgactctgctcaagtgttgaag
gaagtccaagaatgcaaaacggagtaccctaacgctttcatcaggatcatcggattcgac
aacaaccgtcaagtccagtgcatcagtttcatcgcctacaagccaccaagcttcaccggt
gcttaa

DBGET integrated database retrieval system