KEGG   Bacillus cereus NC7401: BCN_0237Help
Entry
BCN_0237          CDS       T01686                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00473  D-Alanine metabolism
bnc00550  Peptidoglycan biosynthesis
bnc01100  Metabolic pathways
bnc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCN_0237
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCN_0237
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BCN_0237
Enzymes [BR:bnc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BCN_0237
Peptidoglycan biosynthesis and degradation proteins [BR:bnc01011]
 Precursor biosynthesis
  Amino acid ligase
   BCN_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAL16030
LinkDB All DBs
Position
240540..241625
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEVLKMSGAENAISPLSLSTEIIPSANAEENAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASAAGMDKVVMKNIFAEAGLKQAKYASFIRSGWEKDRETAYEKVEEVLGYPC
FVKPANLGSSVGINKCKNREELENAFEEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKRDAIVAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAMERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ctacaaacggctcttgctgctattaaagcattaaatcaagataaattcgagattcatcca
atttatattacagaacaaggtcaatgggtacgcggtgagcgtattgaaggtgaagtaaca
gatgttgaagttctaaaaatgagcggtgcagaaaatgcgatttctccgctatcattaagc
acagaaatcattccatctgcaaatgctgaggaaaatgctatcgacgttattttcccatta
ctacatggaccaaatggtgaagatggaacggtacaaggattattagaattaatgaatatt
ccttatgtaggaaatggtgttctagcatctgctgctggtatggataaagttgttatgaaa
aacattttcgcagaagctggattaaaacaagcgaaatatgcatcattcattcgtagcgga
tgggaaaaagatcgtgaaacagcatatgaaaaagtagaagaagtattaggatacccttgc
ttcgtaaaaccagcaaaccttggttcaagtgttgggattaataagtgtaaaaatcgtgaa
gaacttgagaatgcatttgaagaggcattccaatttgaccgtaaaattattgtggaagaa
aatatcgttggacgtgaagtagaagttggtgtactaggtaatgatgaaccgaaatgttca
gttgtaggtgaaatcgtacctaaaaaagacttctatgattataagtcgaaatacatcgat
ggtgatacagcgttaattattccagctgaaatgacagaagaagagtctaatgttattaag
agagatgcgattgttgcattccaatcgttagatggtgctggcttaacgcgagctgatttc
ttcttaacgaaagatggagaagtatacattaacgaagtgaatacgatgccaggatttacg
ccgtttagtatgttccctctactatggcaacatactggattaccgtatccggaattaatt
gaagagctaattcgtttagcaatggagcgtcacgaagaaaaacaaaaaattaaatataca
atctaa

DBGET integrated database retrieval system