KEGG   Burkholderia oklahomensis C6786: BG90_3383Help
Entry
BG90_3383         CDS       T03861                                 

Definition
(GenBank) hypothetical protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
boc  Burkholderia oklahomensis C6786
Brite
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BG90_3383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:3787698..3788402
Genome map
AA seq 234 aa AA seqDB search
MSDLSEFPITKKWPAQHPDRIQLYSLPTPNGVKVSILLEETGLPYEPHVVRFDTNDQMSP
EFLSLNPNNKIPAIIDPHGPGGKPLALFESGAILLYLADKTGQFVPADPARRYETIQWLM
FQMGGIGPMFGQVGFFHKFAGREYEDKRPRDRYVGEAKRLLAVLDGRLADRTWIMGDAYT
IADIATFPWVRNLIGFYEARELVEFDRYPNVARALDAFLARPAVARGLNIPARP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatctctccgagttccctatcacgaagaaatggcccgcgcagcatccggaccgc
atccagctctattcgctgccgacgccgaacggcgtcaaggtgtcgatcctgctggaggaa
acggggctgccgtacgagccgcacgtcgtgcgcttcgacacgaacgaccagatgtcgccc
gagttcctgtcgctgaaccccaacaacaagattccggcgatcatcgatccgcacggtccg
ggcggcaagccgctcgcgctgttcgaatcgggcgcgatcctgctctatctcgccgacaag
accggccagttcgttccggccgatcccgcgcgccgctacgagacgatccagtggctgatg
ttccagatgggcggcatcgggccgatgttcggccaggtcggcttcttccacaagttcgcg
ggccgcgagtacgaggacaagcgtccgcgcgaccgctacgtcggcgaggcgaagcgcttg
ctcgcggtgctcgacggccgcctcgcggaccgcacgtggatcatgggcgacgcctatacg
atcgccgatatcgcgacgttcccatgggtgcgcaacctgatcggcttctatgaagcgcgc
gagctcgtcgaattcgaccgctatccgaacgtcgcgcgcgcgctcgacgcgtttctcgcg
cggcccgcggtcgcgcgcgggttgaacattcccgcgcggccgtag

DBGET integrated database retrieval system