KEGG   Burkholderia oklahomensis C6786: BG90_5708Help
Entry
BG90_5708         CDS       T03861                                 

Definition
(GenBank) acyltransferase family protein
Organism
boc  Burkholderia oklahomensis C6786
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:complement(2449693..2452536)
Genome map
AA seq 947 aa AA seqDB search
MEHTHRLSDNATRLLALLDALLAELYGERNGHRHATLDAQFERDLGFDSLTRAELFDRIE
RAFGVRLPVDVFASAATSADVVRALADAHARAQPHAAAGDEAVSMSPADAAAWPVDVDTL
IDALRWHAERHPDRVHLRLLEDGLTATPLTYGELYRRASDMASGLRERGIDPGDTVALML
PTGFDYFVSFAAILFCGAIPVPIYPPANLAQLDEHVGRHTPILENARIKALIAFRPAVSI
AQLLKLRVSTLQHVLTPEQIAGRAHLPPFRAAADDVALLQYTSGSTGTPKGVMLSHANLL
ANIRAMGDRMRVDASDVLVSWLPLYHDMGLIGAWLAPLYFGIPAIVMSPVVFLARPALWL
RAISRYRGTITAAPNFAYERCARHLAALEPTEFDLSSLRFAFCGAEPVNPDTLRAFAARF
ASCGFDARVLTPVYGLAENTLGLTFPAPALGLRVDRVAREPLSASGRATPAPGDANALDV
PSCGYPLDGTELRIVDDGEREVAERQVGRIEFRGTSATRGYYRNPTQTARLFHDSWRDTG
DLGYVADGELYITGRAKDMIIRGGQHFFPYELEEAIERLPGAVTGGVAVCGGADPVSGTE
RVVILVESDATDDAACERLRASVNDVTAALWGMPAEQVSIVAPHGILKTPSGKIRHAATL
EQFERHAGRLPQAPASWRQFADLAAGSVAPFGRRASRRAAHVLRGLYCWALAALLAPALW
ALVAYRKDPQDNWPLAAYACHTFLRLAGVRTNLIADPDALAAGPSIVVANHTSYMDVVAL
LALLPQPVHFVAKRELATRPFAGRFLRALGTRFVERREYSRSIEDEARLVAQAAADDTLL
FFPEGTFTRAAGLGAFRLGAFRAACVARRPVVPVVVSGARAVLRDGEWLPRRGEITVTML
APIRPDGTDFGAMARLRDRARGAILAHCGEPDLRDGGAQRVEFAPAA
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacgcaccgcctatccgacaacgcaacgcgattgctcgcgctgctcgacgcg
ttgctcgccgagctgtacggcgagcggaacggccatcgccacgcgacgctcgatgcgcag
ttcgagcgcgatctcggcttcgacagcctgacgcgcgcggagttgttcgaccggatcgag
cgtgcgttcggcgtgcgcttgccggtcgacgtgttcgcgtccgccgcgacgtccgcggac
gtcgtgcgcgcgctggccgacgcacacgcacgcgcgcaaccgcacgccgctgccggcgac
gaagccgtgtcgatgtcgcccgccgacgccgccgcgtggcccgtcgacgtcgacacgctg
atcgacgcgttgcgctggcatgccgagcgtcatccggatcgcgtccatctgcgattgctc
gaagacggcctgacggcgacgccgctcacgtatggcgagctgtatcggcgcgcgtcggac
atggcgagcggcctgcgcgagcgcggcatcgatccgggtgacacggtcgcgctgatgttg
ccgacggggttcgactacttcgtgtcgttcgccgcgattctgttctgcggcgcgattccg
gtgccgatctatccgcccgccaatctcgcgcagctcgacgagcacgtcgggcgccacacg
ccgatcctcgaaaatgcgcggatcaaggcgctgatcgcgtttcgcccggccgtctcgatc
gcgcagctgctgaagctgcgcgtgagcacgctgcagcacgtgctcacgcccgagcagatc
gcgggccgcgcgcatctgccgccgtttcgcgcggcggccgacgacgtcgctttgcttcag
tacacgtcgggcagcaccggcacgccgaagggcgtgatgctcagtcatgcgaatctgctc
gcgaacattcgcgcgatgggcgaccggatgcgcgtcgacgcgtccgacgtgctcgtgagc
tggctgccgctgtatcacgacatgggactgatcggcgcgtggctcgcgccgctttatttc
ggcatcccggcgatcgtgatgtcgcccgtcgtgttcctcgcgcggccggcgctctggctg
cgcgcgatctcgcggtatcgcggcacgatcaccgccgcgccgaacttcgcgtacgagcgc
tgcgcgcgccatctcgccgcgctcgaaccgaccgaattcgatctgtcgtcgctgcgcttc
gcgttctgcggcgcggagcccgtcaatccggacacgctgcgcgcgttcgccgcgcgcttc
gcgtcgtgcggcttcgacgcgcgtgtgctgacgcccgtctacgggctcgcggaaaacacg
ctcgggttgacgtttccggcccccgcgctgggactgcgggtcgatcgcgtcgcgcgcgag
ccgctcagcgcgagcggccgcgcgacgcccgcgcccggcgacgcgaacgcgctcgacgtg
ccgagctgcggctatccgctcgacggcaccgagctgcggatcgtcgacgacggcgagcgc
gaggtcgccgagcggcaggtcgggcgcatcgagtttcgcggcacgtcggcgacgcgcggc
tattaccgcaatcccacgcagaccgcgcgcctgttccacgatagctggcgcgacaccggc
gatctcggctacgtcgccgacggcgagctgtacatcaccggacgcgcgaaggacatgatc
atccgcggcggccagcatttctttccatacgagctggaggaggcgatcgaacggctgccg
ggcgccgtgacgggcggcgtcgcggtgtgcggcggcgccgatccggtgagcggaaccgag
cgggtcgtgattctcgtcgagagcgacgcaaccgatgacgccgcgtgcgagcgtctgcgc
gcgagcgtcaacgacgtgacggccgcgctctggggcatgccggccgagcaggtgagcatc
gtcgcgccgcacggcatcctgaagacgccgagcggcaagattcgccacgcggcgacgctc
gagcagttcgagcgccacgccggacggctgccgcaggcgcccgcgtcgtggcggcagttc
gccgacctcgcggccggcagcgtcgcgccgttcggccggcgcgcgtcgcggcgcgcggcg
cacgtgctccgggggctgtactgctgggcgctcgcggcgctgctcgcgcccgcgctgtgg
gcgctcgtcgcgtaccggaaggatcctcaggacaactggcctctcgcggcatacgcgtgc
cacacgttcctgcgtctcgccggcgtgcgcacgaacctgatcgccgatcccgacgcgctt
gcggccgggccgtcgatcgtcgtcgcgaatcatacgagctatatggacgtcgttgcgctg
ctcgcgctgctgccgcaaccggtgcacttcgtcgcgaagcgcgaactcgcgacgcgaccg
ttcgccggccgcttcctgcgcgcgctcggcacgcggttcgtcgagcggcgcgagtacagc
cgcagcatcgaggacgaggcgcggctcgtcgcgcaggcggccgccgacgatacgctgctg
ttcttcccggaaggcacgttcacgcgcgcggcggggctcggcgcgttccgcctcggcgcg
tttcgcgcggcgtgcgtcgcgcggcggccggtggtgcccgtcgtggtgagcggcgcgcgc
gccgtgttgcgcgacggcgaatggctgccgcgccgcggggagatcaccgtgacgatgctc
gcgccgatccggcccgacggcacggacttcggcgcgatggcgcggctgcgcgaccgcgcg
cgcggcgcgattctcgcgcattgcggcgagccggacttgcgcgacggcggcgctcagcgc
gtggagttcgcgccggccgcgtaa

DBGET integrated database retrieval system