KEGG   Brassica oleracea (wild cabbage): 106311995Help
Entry
106311995         CDS       T04124                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:boe00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    106311995
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106311995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
C8
AA seq 152 aa AA seqDB search
MAKGVAVLNSSEGVKGTIFFTHEGNGATTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPDGKTHGAPEDANRHAGDLGNIIVGDDGTATFTITDSQIPLSGPNSIVGRAVVVHA
DPDDLGKGGHELSLSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggagttgcagttctgaacagcagtgagggtgttaaggggaccatcttcttc
acccatgaaggaaacggtgccactactgtgacaggaactgtttctggccttaaacctggt
ctccatggtttccatgtccatgctcttggtgacaccactaacggttgcatgtctaccggt
ccacatttcaaccctgatggtaaaactcacggtgcaccggaggatgctaatcgtcatgct
ggcgatctaggaaacatcattgttggggatgatggaactgccaccttcacaatcactgac
agccagattccccttagtggtccaaactctattgtcggaagggccgttgttgtccacgca
gaccctgatgacctcggaaagggaggccatgaactcagcttgtctactggaaacgcaggc
ggccgtgttgcttgtggtattattggtcttcagggctaa

DBGET integrated database retrieval system