KEGG   Brassica oleracea (wild cabbage): 106342891Help
Entry
106342891         CDS       T04124                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain F1, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    106342891
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106342891
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     106342891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
C4
AA seq 181 aa AA seqDB search
MASSMLSSAAVATSPAQATMVAPFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWP
PVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTG
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctctcctccgccgctgtggctacctcaccggctcaagccaccatg
gttgctccattcaccggcttgaagtcatccgctgcattcccagtcacccgcaaaagcaac
actgatattacttccattgcaaacaacggaggaagagttagctgcatgaaggtgtggcca
ccagttggaaagaagaagtttgagactctctcttatcttcctgaccttactgacgttgaa
ttggccaaagaagttgactaccttctccgcaacaagtggattccttgtgttgaatttgag
ttggagcacggatttgtgtaccgtgagcatggaagcacacctggatactacgatggccgt
tattggacaatgtggaagcttcctttgtttggatgcactgactctgctcaagtgttgaag
gaagtgcaagagtgcaagacggagtaccctaacgcctttattagaatcattggattcgac
aacaaccgtcaggtccagtgcatcagtttcatcgcctacaagccaccaagcttcaccggt
gcttaa

DBGET integrated database retrieval system