KEGG   Bordetella sp. H567: AKI39_10375Help
Entry
AKI39_10375       CDS       T04979                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
boh  Bordetella sp. H567
Pathway
boh00010  Glycolysis / Gluconeogenesis
boh00020  Citrate cycle (TCA cycle)
boh00620  Pyruvate metabolism
boh01100  Metabolic pathways
boh01110  Biosynthesis of secondary metabolites
boh01120  Microbial metabolism in diverse environments
boh01130  Biosynthesis of antibiotics
boh01200  Carbon metabolism
Module
boh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:boh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AKI39_10375
   00020 Citrate cycle (TCA cycle)
    AKI39_10375
   00620 Pyruvate metabolism
    AKI39_10375
Enzymes [BR:boh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AKI39_10375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C HlyD_D23 RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: AOB31011
UniProt: A0A1B2R214
LinkDB All DBs
Position
2317723..2319414
Genome map
AA seq 563 aa AA seqDB search
MSNTVEIKVPDIGDFKEVEVIEVLVAPGDTIKPEQSLITVESDKASMEIPSSEGGVVKSV
KVKVGDKVSMGTVVLELEAGGAAEAPAAAPAKQEEKPAAQPQSQPAQAAAQPQAAAPAPA
PAGGGEAVIEVPDIGDFKEVEVIEVMVAVGDTIKTEQSLITVESDKASMEIPASQGGVVK
EVRVKVGDKVSKGTPLVVVEGGAPAAAPSGQAAAPAPAAAPAQAAPASAAAAAPAPAAAA
RPAPPAAALPAADLKPGQLPHASPSVRKFARELGVDLARVAGSGPKGRITQEDVRGFVKQ
ALAGGAPAAAGAAAGGNVGGLNVLAWPQIDFSKFGPVEAKPLSRIKKISGANLHRNWVMI
PHVTNNDEADITDLEALRVTLNKENEKAGIKVTMLAFLIKAIVAALKKFPEFNASLDGDN
LVLKQYYHIGFAADTPNGLVVPVLRDADKKGILDLARETSEMARKARDGKLSPSEMQGGC
FSISSLGGIGGTHFTPIINAPEVAILGVSRSEFKPVWDGKQFVPRLKLPLSLSYDHRVID
GAAAARFNAYLGALLADFRRIAL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatacggtggaaatcaaggtacctgacatcggcgacttcaaggaagtcgaagtc
atcgaagtgctggtggctcccggcgacacgatcaagcccgaacagagcctgatcacggtg
gagtcggacaaggcgtccatggaaatcccgtcgtccgaaggcggggtggtcaagtcggtg
aaggtcaaggttggcgacaaggtgtccatgggcacggtcgtcctggaactggaagcgggc
ggcgcggccgaagcgcccgccgccgcgccggcgaagcaggaagaaaagcccgcggcccag
ccccagagccagcctgcccaggcggccgcgcagccccaggcggcggcgcccgcgcccgcg
cccgcgggcggcggcgaagccgtcatcgaggtgccggacatcggggacttcaaggaagtc
gaggtcatcgaagtgatggtcgctgtcggcgacacgatcaagaccgagcaaagcctgatc
acggtggagtcggacaaggcctcgatggaaatccccgcgtcgcagggcggcgtggtgaag
gaagtgcgcgtcaaggtgggtgacaaggtgtccaagggcacgccgctggtcgtggtggaa
ggcggcgccccggctgccgcgccgtccggccaggccgccgcgcccgctccggccgccgcc
ccggcgcaggccgcaccggcaagcgcggctgccgcggcgcccgcgcccgcggctgccgca
cggccggcgccccccgctgccgcgttgcccgccgccgatctcaagcccggccagctgccg
cacgcgtcaccgtcggtgcgcaagttcgcgcgcgaactgggcgtggacctggcgcgcgtg
gcgggcagcggcccgaagggccgtatcacgcaggaagacgtgcgcggcttcgtcaagcag
gccttggccggcggcgcgcccgccgcggccggcgcggcggcaggcggcaatgtcggcggc
ctgaacgtgctggcctggccgcagatcgacttcagcaagttcggtcccgtcgaagccaag
ccgctgtcgcgcatcaagaagatttccggcgcgaacctgcaccgcaactgggtcatgatc
ccgcacgtcaccaataacgacgaagcggacatcaccgacctggaagcgctgcgcgtgacc
ttgaacaaggaaaacgagaaggccgggatcaaggtcaccatgctcgccttcctgatcaag
gcgatcgtggcggcgctgaagaagttccccgagttcaacgcatcgctggatggcgacaac
ctggtgctcaagcagtactaccacatcggcttcgcggccgacacgcccaatgggctggtg
gtgcccgtgctgcgcgatgcggacaagaaaggcatcctggacctggcgcgcgaaacctcc
gaaatggccaggaaggcgcgcgacggcaagctgtcgccgtccgaaatgcagggcggctgc
ttctcgatatcctcgctgggcgggatcggcggcacgcatttcacgcccatcatcaatgcg
cccgaagtggccatcctgggcgtgtcgcgctccgagttcaaaccggtatgggacggcaag
cagttcgtgccgcgcctgaagctgccgctgtcgctgtcctatgaccaccgtgtcatcgac
ggcgcggccgccgcccgcttcaatgcctatctgggtgcgctgctggccgacttccgccgc
atcgcgctgtaa

DBGET integrated database retrieval system