KEGG   Bordetella sp. H567: AKI39_20490Help
Entry
AKI39_20490       CDS       T04979                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
boh  Bordetella sp. H567
Brite
Enzymes [BR:boh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AKI39_20490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4577557..4578111
Genome map
AA seq 184 aa AA seqDB search
MKHSHSRKILLAVAGTAAATAAALCAAATAQADVTVPMALATPTGKGEDIGTVTLSQNKY
GLVLTPNLKGLPPGLHGFHIHEKGDCGPAQQDGKPVPAGAAGGHYDPNQAKKHGAPWGDG
HRGDLPALYVDNGGNATNPVLAPRLKLSEVHKHALMIHVGGDNHSDHPMPLGGGGGRAAC
GVIP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattcccattcccgcaagattctgctggccgtcgccggtacggccgccgccacc
gccgccgcgctgtgcgcggccgccaccgcgcaggccgacgtcacggtcccgatggcactg
gccacgcccaccggcaagggcgaagacatcggtaccgtcacgctgtcgcagaacaagtac
ggcctggtcctgacgcccaacctgaaaggactgcccccagggctgcacggcttccacatc
cacgagaagggcgattgcggcccggcgcagcaggacggcaagcccgtgccggccggcgcc
gcgggcggacactacgaccccaaccaggcgaagaagcacggcgccccgtggggcgacggc
caccgcggcgacctgccggcgctgtatgtggacaatggcggcaatgccaccaatcccgtg
ctcgcgccacgcctgaagctttcggaagtccacaagcacgcgctgatgatccacgtcggg
ggcgacaaccacagcgaccatcccatgccgctgggcggcggcggcggccgcgcggcgtgc
ggcgttatcccatga

DBGET integrated database retrieval system