KEGG   Burkholderia oklahomensis E0147: DM82_651Help
Entry
DM82_651          CDS       T03284                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bok00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DM82_651
Enzymes [BR:bok01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DM82_651
Transporters [BR:bok02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM82_651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:749071..749727
Genome map
AA seq 218 aa AA seqDB search
MLRLCGLPLSNYYNKVKFVLLEHDIPFEETLVKLPIDDPSLFADTPLGKVPYLLTEHGAI
SESQAIVEYLAATHPGKRLFPADPFAAAKAREITTVLELYLEWNVRELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFGIADVAAFIHLPVVALATKAVYGRDFLA
DAGIDWKSYVKRIEEERPAARRVSEERKAFIAGLAKPS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggctctgtggcttaccgctgtccaactattacaacaaggtcaagttcgtactg
ctcgagcacgacattccgttcgaggaaacgctcgtcaagctgccgatcgacgatccctca
ctgttcgccgacacgccgctcggcaaggtgccgtatctgctgaccgagcacggcgcgatc
agcgaatcgcaggcgatcgtcgaatatctcgccgcgacccatcccggcaagcgcctcttc
ccggccgatccgttcgcggcggcgaaggcacgcgagatcacgacggtgctcgagctgtat
ctcgaatggaacgtgcgcgagctgtttccggaggcgttcttcggcggcaaggtcagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctcgacggcttcaagcggctc
gcgaaattctcgccttacgtgctcggcgacacgttcggcatcgccgacgtcgctgcgttc
atccatttgccggtcgtcgcgcttgcgacgaaagcggtttacggccgcgatttcctcgcc
gatgccggaatcgactggaagtcgtacgtgaagcgcatcgaggaggagcggccggcggcg
cggcgcgtgagcgaagagcgcaaggcgttcatcgcggggcttgcgaagccgagttga

DBGET integrated database retrieval system