KEGG   Bos mutus (wild yak): 102280102Help
Entry
102280102         CDS       T02919                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00730  Thiamine metabolism
bom00790  Folate biosynthesis
bom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    102280102
   00790 Folate biosynthesis
    102280102
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102280102
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102280102
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Enzymes
  102280102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 102280102
NCBI-ProteinID: XP_005911187
UniProt: L8HPE5
LinkDB All DBs
Position
Un
AA seq 531 aa AA seqDB search
MQGACVLLLLGLRLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVSTVTAARILKGQMAGKLGPETPLAMDQFPYLALSKTYNVDRDVPDSAGTTTAYLC
GVKTRMKVIGVSAAAQFNQCNTTYGNEVTSVMNRAKKAGKSVGVVTTTTVQHASPAGAYA
HTVNRNWYSDANMPAEAKREGCQDIATQLVYNMDIDVILGGGRIYMFPEGTPDPEYPGNT
KQNGVRKDKRNLVQEWQAKHQGAQYVWNRTALLQAANDSSVTHLMGLFEPGDMTYDIHRD
HIKDPSLEEMTEAAVRVLSRNPRGFFLFVEGGRIDHGHHESIAYRALTEAVMFDNAIAKA
SQLTSEADTLTLVTADHSHVFTFGGYPLRGTSIFGLADGKAKDGKSYTTLLYGNGPGHRL
VMGSRPDVNEKESMDPNYKQQAAVPLWSETHAGEDVAVFARGPWAHLVHGVQEQTFVAHV
MAFAACVEPYTTDCHPHPHSGPLDTAHQAACPSSLALLAGALLLLLVPTLH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggcctgcgtgctgctgctgctgggcctgcggctacagctctccctcggcctc
gtcccagtcgaggaggaagaccctgccttctggaaccgccaggcagcccaggccctcgat
gtggctaagaagctgcagcccatccagacagccgccaagaatgtcatcctcttcttgggc
gatgggatgggggtttccacggtgacagccgctcggatcctaaaggggcagatggctggc
aagctgggacctgagacacccctggccatggaccagttcccatacctggctctgtccaag
acatacaacgtggacagagatgtgcccgacagcgcaggcacgaccactgcctacctgtgt
ggggtcaagacccgtatgaaggtcatcggtgtaagtgcagccgcccaatttaatcagtgt
aacacgacatatgggaacgaggtcacatctgtgatgaaccgggccaagaaagcagggaag
tctgtgggagtggtgaccaccaccacagtgcagcacgcctccccagccggggcctacgcg
cacacggtgaaccgaaactggtattctgatgctaatatgcctgccgaggccaagagggag
ggctgccaggacattgccacacagctggtctacaacatggacattgacgtgatcctgggt
ggaggccgaatatacatgtttcctgagggaaccccagaccctgaatacccaggcaataca
aaacagaatggagtccggaaggacaagcggaacctggtgcaggagtggcaggccaagcac
cagggagcccagtatgtgtggaaccgcacggcactccttcaggcggctaatgactccagt
gtaacacacctcatgggcctctttgagccaggagatatgacctatgacatccaccgagac
cacatcaaggacccatctctggaggagatgacggaggcagccgtgcgtgtgctgagcaga
aaccctcggggcttcttcctcttcgtggagggaggccgcattgaccacggtcaccatgaa
agcatagcttatcgggcactgaccgaggcggtcatgttcgacaatgccatcgccaaggct
agccagctcaccagtgaagcagacacactgacccttgtcaccgccgaccactcccatgtc
ttcactttcggtggctatccacttcgtgggacctccatttttgggctggccgatggcaag
gccaaagatggcaagtcctataccacccttctctatggcaacggcccggggcaccggctg
gtcatgggctcacgacctgatgtgaatgaaaaggagagcatggaccccaactacaagcaa
caagccgcagtgcccctatggagcgagacccacgccggtgaggacgtggcagtgtttgca
cgaggcccgtgggcacacctggtgcacggcgtgcaggagcagaccttcgtggcgcatgtc
atggcctttgctgcctgcgtggagccctacaccaccgactgccaccctcacccccatagc
ggtcccttggacactgcccaccaggctgcctgcccatcctcactggcactgctggccggg
gccctactgctgctgctggtgcccaccctgcactga

DBGET integrated database retrieval system