KEGG   Bos mutus (wild yak): 102282347Help
Entry
102282347         CDS       T02919                                 

Definition
(RefSeq) cationic trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
bom  Bos mutus (wild yak)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:bom00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102282347
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    102282347
   04974 Protein digestion and absorption
    102282347
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102282347
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102282347
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102282347
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102282347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVAEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLQCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGYGCAQKNKPGVYTKVCNYVSWIK
QTIASN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatctttctagctctcctgggagctgctgttgctttccccgtggacgat
gatgacaagatcgtgggcggctacacctgtggggcaaatactgtcccctaccaagtgtcc
ctgaactctggctaccacttctgcgggggctccctcatcaacagccagtgggtggtgtct
gcggctcactgctacaagtccggaatccaagtgcgtctgggagaagacaacattaatgtc
gctgagggcaatgagcaattcatcagcgcatccaagagcatcgtccatcccagctacaac
tcaaacaccttaaacaacgacatcatgctgattaaactgaaatcagctgccagtctcaac
agccgagtagcctctatctctctgccaacatcctgtgcctctgctggcacccagtgtctc
atctctggctggggcaacaccaaaagcagtggcaccagctaccctgatgtcctgcagtgt
ctgaaggctcccatcctatcagacagctcttgcaaaagtgcctacccaggccagatcacc
agcaacatgttctgtgcgggctacctggagggcggaaaggactcctgccagggtgactcc
ggtggccctgtggtctgcagtggaaagctccagggcattgtctcctggggctatggctgc
gctcagaaaaacaagcctggtgtctacaccaaggtctgcaactacgtgagctggattaag
cagaccatcgcctccaactaa

DBGET integrated database retrieval system