KEGG   Bos mutus (wild yak): 102287783Help
Entry
102287783         CDS       T02919                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102287783 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 830 aa AA seqDB search
MPSPTPSSGGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRN
TEDDDWGPERHGDRGGRGSGSRNRRPDSRGSDSRQPGSRDSRRPGSRGSAVNAAGDGTIR
EGMLVVTGVDLLSSRSDQNRREHHTDEFEYDELILRRGQPFQMVLFLSRPYESSDHVTLE
LCIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLNLRVHTSPNAIIGKFQFTIRT
RCEAGDFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGER
TWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDY
SRGTNPSAWVGSVEILLSYLRTGNSVPFGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHD
TDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETS
SGIFCCGPCSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGSL
IITKAIGSNMREDITHTYKHPEGSEAERKAVETAAAHGSKPNVYATRDSAEDVAVQVEAQ
DAVMGQDLMVSVVLTNRGSSLRTVKLHLYLSVTFYTGVTGSVFKESKKEVVLAPGASERV
TMPVAYKEYRVHLVDQGAMLLNISGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQE
CEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQL
IASLDSPQLSQVHGVIQVDVAPASGGGAFSDIRGSGRSGETIPMASRGGA
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgccaacaccttcatcaggcggtcctcgttcagatgtcggccgctggggcgga
aacccctggcagccccccaccacaccttctccagagccagaaccagagccagacagacgt
tctcgccgcgggggccgttccttctgggctcgctgctgtggctgctgctcttgccggaac
acagaagacgatgactgggggcctgagcgccatggagaccggggaggtcgaggatctggc
tccaggaatcgaagacccgactcccggggctcagactcccgccagcctggctcccgggac
tcccgccggcctggctcccggggcagtgctgtgaacgcagctggagatggcaccatccgg
gagggaatgctggtggtgactggtgtggatctgctgagttcacgctcagaccagaaccgc
cgagagcaccacacggacgagttcgagtacgatgagctgattctccgccgtgggcagcct
ttccaaatggtcctcttcctgtctcgtccctatgagtcgtctgatcatgtcaccctggag
ctgtgcatcggaaataatcccgaggtgggcaagggcacccatgtgatcatcccggtgggc
aaggggggcagtggaggctggaaggcccaggtgaccaagtccagtgggcagaatctgaac
ctacgggtccacacctcccccaatgccatcatcggcaagttccagttcaccatccgcaca
cgctgtgaagctggagatttccaattgccctttgacccccgcaatgagatctacatcctc
ttcaatccctggtgcccagaggacatcgtgtatgtggaccatgaggactggcggcaggag
tatgtgcttaatgagtctgggcgaatttactatgggacagaagcgcagattggcgagcgg
acctggaactacggccagtttgaccacggggtgctggacgcttgcctgtacatcctggac
cggcggggcatgccctatggaggccgcggggaccccgtcagtgtctcccgggtcatctct
gccatggtgaactccttggatgacaatggggtcctgattgggaactggtctggagattat
tcccgcggcaccaacccatcagcatgggtgggcagcgtggagatccttctcagctaccta
cgcaccggcaactctgtccccttcggccagtgctgggtcttcgctggtgtgaccaccaca
gtgctgcgctgcctgggcctggccacccgtactgtcaccaacttcaactccgcgcacgac
acagacacttccctcaccatggacatctacttcgatgagaacatgaagcccctggagcac
ctgaaccatgattctgtctggaacttccacgtgtggaacgactgttggatgaagaggcca
gatctgccctcaggcttcgatggatggcaggttgtggacgccacaccccaggaaaccagc
agtggcatcttctgctgtgggccctgctctgtgcagtccatcaagaatggcttggtctac
atgaagtacgacacacccttcatttttgcagaggtgaacagtgataaagtttactggcag
cgacaggatgacggcagcttcaagatcgtgtatgtggaggagaaggccatcggctcactc
atcattacgaaggccattggctccaacatgcgggaagacatcacgcacacttataagcac
ccagaaggctcagaagcagagcggaaggcagtggagaccgcagccgcccacggcagcaaa
cccaatgtgtatgccacgcgggactcagcggaggatgtggccgtgcaggtggaggcgcag
gacgcagtgatggggcaggacctgatggtctccgtggtgctgaccaaccgcggcagcagc
ctccgcaccgtgaagctgcacctctacctctctgtcaccttctacaccggcgtcacggga
tccgtcttcaaggagagcaagaaggaggtggtgctggcgccgggggcctcggagcgtgtg
accatgcctgtggcctacaaggaataccgggtccacctcgtagaccagggggccatgctg
ctcaacatctcaggccacgtgaaggagaacgggcaggtgctggccaagcagcacaccttc
cgtctgcgtaccccagacctcagtctcacgttactgggagcagccgtggttggccaggag
tgcgaagtacagattgtcttcaagaacccgctgcctgtcaccctcaccaacgtcgtcttc
cggctcgagggctccgggttgcagaggcccaagatcctcaatgttggggacattgggggc
aacgagacagtgaccctgcgccagacgttcgtgcctgtgagaccaggcccccgccagctc
attgccagcttggatagcccacagctctcccaggtgcacggggtcatccaggtggacgta
gccccggccagcggaggcggggccttctcagacattagaggcagcggtcgctcaggggag
accatccccatggcctctcgaggtggggcttag

DBGET integrated database retrieval system