KEGG   Bipolaris oryzae: COCMIDRAFT_105627Help
Entry
COCMIDRAFT_105627 CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bor  Bipolaris oryzae
Pathway
bor00250  Alanine, aspartate and glutamate metabolism
bor00410  beta-Alanine metabolism
bor00430  Taurine and hypotaurine metabolism
bor00650  Butanoate metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
Module
bor_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bor00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    COCMIDRAFT_105627
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCMIDRAFT_105627
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCMIDRAFT_105627
   00430 Taurine and hypotaurine metabolism
    COCMIDRAFT_105627
Enzymes [BR:bor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     COCMIDRAFT_105627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19118717
NCBI-ProteinID: XP_007691857
JGI: Cocmi1_105627
UniProt: W6Z1W0
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MSSAPGNTPLNRADEVKDLLDAVQELIIPFIRSADEDAATKHTGHGLRIEGSGGPRTTIV
EHHPPKKLESILSEELEINDKKVGKDGLVKLVSTVLKYSVNTWDQGFLDKLYASTNAVGV
VSELLLAVLNTNAHVYHVSPVLTLVEKRTTKYLASLFGLPEKTCGGISQPGGSAANASAI
VIARNTLFPETKTEGNGTHKFTLFTSAHGHYSVEKAANLFGLGSKNVIAVPVDDHGRMIP
SELERLVTESKTRGEAPFFVNATAGTTVHGSFDPFPALSSICKSHNLWLHIDGSWGGSVI
FSPTYSPPRLAGSDLADSITVNPHKMLGVPMTSSFLLGKDMNTFYRALTLPAGYLFHNAP
GTDAQDIYDLADLTPQCGRRADSLKFFLALQYYGPQHFSDLVDRAYDNAEYLLQKLKDGG
HFKTISPEPLPCLQVCFYYAKNGAVNEDAEKNSKATTEIAQRLVSRGFMVDFAPGEQGKF
FRVVVNGNVGRGTLDGLVKAIEDVAAELEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcacccggaaatacgcctctcaatcgggctgatgaagtcaaagatcttctt
gatgccgtccaagagttgatcataccattcatccgctctgcagacgaagatgctgctact
aagcacactggccatggtctacgaatagaaggtagtggtggcccaagaactacaatcgtt
gagcatcatcctcctaagaagctggagtctatcctcagcgaagagctggaaattaatgac
aaaaaagttgggaaagatggactagtcaagctggtgagcaccgtgctaaagtatagcgta
aacacttgggatcaagggttcctggacaaactatatgcgagtacgaacgcggtaggcgta
gtcagtgagctgcttctggctgtgttgaacaccaatgcccatgtctaccacgtctcaccc
gtactaaccctcgtcgaaaaacgaacaacaaagtacctagcttctctctttggcctgcca
gagaaaacttgtgggggaatctcccaaccaggtggcagtgccgctaatgcctccgccatc
gtcatcgctagaaacaccctgttcccagagaccaaaaccgagggcaatggaacccacaaa
tttaccctcttcacctcagcccacggtcattactctgtagaaaaagccgccaatctcttc
ggcctcggctccaaaaacgtcatcgccgtccccgtcgacgaccatggccgcatgatcccc
tccgaactcgagcgcctcgtcaccgaatccaagacccgcggcgaagcccccttcttcgtc
aacgccacagcaggcaccaccgtccacggctcattcgaccccttccccgccctctcatcg
atctgcaaatcgcacaacctctggctccacattgacggctcttggggcggcagcgtcatc
ttttcccctacctactccccgccgcgtcttgcaggctccgacctcgcagacagcataacc
gtcaatccccataaaatgctcggcgtacccatgaccagcagcttcttactcggcaaggac
atgaatactttttaccgcgccctcacgctgcccgcaggctacctcttccacaacgccccc
ggcacagacgcccaggatatatacgacctcgcagacctaaccccccaatgcggtcgccgc
gcagacagcctaaagttcttcctcgccctccaatattacggcccccagcatttcagcgac
ttggtcgatagagcctacgacaacgccgagtacctactccagaaactgaaagatggtggt
cacttcaagacgattagtccggagcccctgccttgcttgcaggtgtgcttttactatgcc
aagaatggggcggtgaacgaggatgcagagaagaatagcaaagctacgacggagattgcg
cagaggctggtgagtagggggtttatggttgattttgcgcccggggagcaagggaagttt
tttagggttgtggtgaatgggaatgtgggcagggggacgctggatggcttggttaaggcg
attgaggatgtggcagcggagttggagttgtaa

DBGET integrated database retrieval system