KEGG   Bipolaris oryzae: COCMIDRAFT_81931Help
Entry
COCMIDRAFT_81931  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
bor  Bipolaris oryzae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bor00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    COCMIDRAFT_81931
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCMIDRAFT_81931
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCMIDRAFT_81931
   00430 Taurine and hypotaurine metabolism
    COCMIDRAFT_81931
Enzymes [BR:bor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     COCMIDRAFT_81931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 549 aa AA seqDB search
MAGLARHVDTEELLTTLKDHPMHKAGGRHAENRATSHITPYSSRYAAGTELSKFKIPQDG
APADVVHQLLKDELDLDGRPSLNLASFVGTYMEREGEQLMIENISKNLSDADEYPAMMDM
HARCVSIIAHMWGVQKGEKAIGSATTGSSEAIHLGGLAMKRRWQEKRMAEGKDTSKPNII
MGANAQVALEKFARYFEVEARILPVSEDSSYRLDPKLVKENIDENTIGVFVILGSTYTGH
YEPVEEISEILDEFEKKTGVDIPIHVDAASGGFIAPFTHAKAGRKWNFELPRVKSINTSG
HKFGLVYAGVGWIIWRDESYLPKHLIFELHYLGGTEESYTLNFSRPGAQIIAQYYNLIHL
GFSGYRSIMENTLANARLLSRALEHTGWYRCVSDIHRKKGDFKYEKGKEQFEEGATSEAY
NPGLPVVAFTLTDDFHKEFPHVKQEAVSNLLRAKQYIIPNYPLPPKEEKTEILRVVVRES
LSVDMIDRLVTDICGVTEMLMKTDAVDLAAFQPGANPSVEKQHASKGLRKEHKHKAQRPT
KDGVYRTVC
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggccggactagcaagacatgttgatacggaagagctcttgacgacgctcaaagaccat
cctatgcacaaggctggcggacgtcatgccgaaaacagagcaacttcgcacatcacccct
tactctagtcgatatgctgctggtaccgaactgtccaagttcaaaattccacaagacggt
gccccggcagacgttgttcaccagttgctcaaagatgagcttgacctagatggacgacct
agcctcaaccttgcttcattcgtcggcacctacatggagagggagggcgagcaactcatg
attgaaaacatatcaaagaatctgtcggatgccgatgagtacccggctatgatggacatg
catgcccgttgcgtgtccatcattgcccacatgtggggtgtgcaaaagggcgaaaaggct
atcgggtctgccaccactggctccagtgaggccattcaccttggtggactcgctatgaag
cgccgctggcaggaaaagagaatggcagagggcaaggacacttccaaaccaaacatcatc
atgggtgccaatgctcaggtagcattggagaaatttgctaggtactttgaagtcgaggcc
cgtattcttcccgtaagcgaggattcatcctaccgcctagaccccaagctagtcaaggag
aatatcgacgagaacactatcggagtttttgtcatcctcggctccacctataccggacat
tatgagcctgttgaagagatctcggaaatcttggacgaattcgagaagaagactggagtc
gacattccgattcacgttgacgcggcatcgggtggcttcatcgctccctttacacatgca
aaggcgggcaggaaatggaatttcgagttgccgcgagtgaagtccatcaacaccagtgga
cataaatttggacttgtgtatgccggtgttggatggatcatatggcgagatgagagctac
ctaccaaagcatttgatctttgaactccactatctgggcggaactgaggagtcgtacacg
ttaaacttctcgcgaccgggcgcccagattattgcgcaatactataacctgattcattta
ggtttctcgggataccgcagcattatggagaacaccctggccaatgcccgtctactgagt
agggcgctggaacacacgggctggtatcgctgtgtcagtgacatccaccgcaaaaagggc
gacttcaagtacgaaaagggcaaggagcaattcgaagaaggcgctacgagcgaggcttac
aatcctggtctacccgtcgtagcctttaccctcaccgatgacttccacaaagaattcccg
cacgtcaaacaagaagccgttagcaatctgctccgtgctaagcaatacatcattcccaac
tacccgcttccccccaaggaggagaagactgagattctgagagtagtagtccgagagtct
ctctcggtcgacatgatcgacaggcttgtgactgacatctgcggcgtgacggaaatgctt
atgaagacggatgccgttgaccttgcggcgttccaaccaggcgccaatcccagcgtcgag
aaacagcacgcgagcaagggcttgaggaaggagcacaagcacaaggctcagcgaccgaca
aaagacggcgtctaccgaacggtgtgttag

DBGET integrated database retrieval system