KEGG   Bipolaris oryzae: COCMIDRAFT_83759Help
Entry
COCMIDRAFT_83759  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bor  Bipolaris oryzae
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bor00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    COCMIDRAFT_83759
Enzymes [BR:bor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COCMIDRAFT_83759
Transporters [BR:bor02000]
 Other Transporters
  Pores ion channels [TC:1]
   COCMIDRAFT_83759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 269 aa AA seqDB search
MGKDHPDADLHPEATGLAAATVKAHSAECPLKLYSGWFCPFVQRVWIALEEKGIQYQYIE
VNPYHKPQSLLDLNPRGLVPTLQYQGKPLYESTVLCEFLEEAFPQHTPHLMPTDPCERAR
IRIWIDYVGSRIIPAYHRFLQHQGDGLEEKQKEFLNHVKEFTREMDKEGPFFSGKEFGLI
DIVIAPWANRLWVFDHFKGGSGIPDEGKGGEDEEVWKRFRKWLAAVEARKSVKETLSDKQ
HYLPIYQRYAEDRAQSEAAKAIRAGRGIP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaccaccctgatgcggaccttcacccagaggctacaggcctggcagcggca
acagttaaggctcactcggcggagtgccctctaaagctctactcgggttggttttgcccc
tttgtccaacgtgtatggattgcccttgaggaaaaaggcatccaatatcaatacattgaa
gtcaacccatatcacaagccacagtctttgcttgatctgaatcctcgcggccttgttccc
acgctgcagtatcagggaaagccgctgtatgagagtactgttctttgcgagtttctcgaa
gaagcgttcccacagcacacaccgcacttgatgcctacggatccctgtgagcgtgcgaga
atcaggatctggatagattatgtgggtagtcgcatcattcctgcctaccaccgcttcctg
caacatcaaggcgacgggctcgaagaaaaacagaaggaattcttgaatcacgtcaaggag
ttcacacgggagatggacaaagaaggaccgtttttctcaggcaaggaattcggactcatt
gacatcgtgattgcaccctgggccaacaggctatgggtctttgatcacttcaaagggggt
tcgggtattcctgacgagggcaagggcggagaggatgaggaggtgtggaagaggttcagg
aagtggctcgctgctgttgaggctaggaaaagtgtcaaggaaacgttgagcgacaagcag
cactatttgcccatatatcaaagatatgcagaggaccgagcccagagtgaggctgcaaaa
gcaattcgggctggtagggggattccctag

DBGET integrated database retrieval system