KEGG   Bipolaris oryzae: COCMIDRAFT_87218Help
Entry
COCMIDRAFT_87218  CDS       T03125                                 

Definition
(RefSeq) glycoside hydrolase family 2 protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bor  Bipolaris oryzae
Pathway
bor00052  Galactose metabolism
bor00511  Other glycan degradation
bor00600  Sphingolipid metabolism
bor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    COCMIDRAFT_87218
  Lipid metabolism
   00600 Sphingolipid metabolism
    COCMIDRAFT_87218
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    COCMIDRAFT_87218
Enzymes [BR:bor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     COCMIDRAFT_87218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Kelch_3
Motif
Other DBs
NCBI-GeneID: 19127010
NCBI-ProteinID: XP_007684977
JGI: Cocmi1_87218
UniProt: W6ZLW9
LinkDB All DBs
Position
Unknown
AA seq 882 aa AA seqDB search
MLSSSGTLYNTYRFILLGFLFSLCFDTTSAHVVKKPRAASTGRVRSSLNADWRFSRFTSN
PDGLSYETLKPWIMPAANDFIVGDKYQRPSGAAPGSNTSYVQSSFDDASWEAVTLPHDWA
ITGTFDAPGVTGDLGFLPINGIGWYRRSVSIDAEIIDSGKSIFLDVEGAMAYAAVWLNGQ
LVGGWPFGYNSFRLDLTPYANAGANTLAIRLDNKLDSSRWYPGAGIYRDVWLVTVDPVHV
AQWGTYITTPSISKAEAMVDIVVEVENKANSSQSVEVTTEIYERDSTSKAAKGNCVATFP
TANTDVAGNSKQTVKGSVSVANPKLWGPAPTQKPNEYVAVTTVSIDGTAVDTYETVFGIR
SIAYDPNQGLLINGERIYVQGSCNHHDLGSLGAAFNVRAAERQIEILMEMGNNALRTSHN
PPAPGYLDLADRMGLLVMDEIFDTWNYAKVENDFHRIFQEWHEPDLRSFIRRDRNHPSII
SWSVGNELREQSNATGTATVKMLQDIAHEEDPTRKVTIGMNNANASTGVAATIDIIGLNY
QGEGKGVSWRSSFPDFKNAFPEKMIWSTESASTISSRGKYLFPVTSNKSAVIGGGPGEGG
DPVTNQISSYDLYAPEWAASPDKVFQMQDMHPYVAGEFVWTGWDYIGEPTPYANVSRSSY
FGIIDLAGFKKDRFYLYQSRWRSDLPMAHILPHWTWPEDRTGETTPVHVYSSGDAAELFV
NGVSAGRKEKAEYEYRFRWDDIKYSPGNVTVVTYKDGAEWATASQVTAGSAASLNITADR
STITGDGYDLSFVSVAVHDSQGTLVPTADHAISFKVTSGPGIIVSTDNGDPTDLVPFPKT
TRKAFGGLALAIVRSEAGATGEIVVEATAEGLEGGSVTITAA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgttgagctcatctgggacgctgtacaacacgtacagattcatcctgctcggcttcttg
ttttcgctttgtttcgatacaacatctgcacatgttgtcaagaaaccgcgtgcggcttca
acgggccgtgtgcgctcgtctctcaacgcagattggcgtttctcacgtttcacgtccaat
cccgatggcctgagctacgagactctgaagccatggattatgcctgctgcaaacgacttc
attgttggagataaataccagcgcccttctggcgctgcacctggctctaacaccagctat
gtgcagtcgagcttcgacgatgcaagctgggaagcagtcactctaccgcacgactgggcc
attaccggaacatttgacgctcctggcgtcactggcgacctaggatttctgccaatcaac
ggaattggatggtaccgaagatcagtttcaattgatgctgagattattgattcaggaaag
tccatcttcctggatgtcgaaggggccatggcctacgctgcggtgtggttgaatggccag
cttgtgggaggatggccttttggctacaattccttccgtctggaccttacgccctacgcc
aatgctggagcaaacacccttgctattcgcttggacaataagctggattcatcccgttgg
taccccggtgctggaatttaccgagatgtttggctggtcaccgtggatcctgtacacgtt
gcgcaatggggaacctacatcaccactcctagcatttcaaaagccgaggcaatggttgat
attgtcgttgaagtcgagaacaaggccaacagcagccagagtgtcgaggtgactactgag
atctacgagcgcgactctacatccaaggcagccaagggcaattgtgttgcgacttttcca
acggcaaacaccgatgtggcagggaactcgaagcaaactgtaaaaggttcagtttctgtg
gcaaaccctaagctttggggacctgcaccgactcagaaacccaacgaatatgttgccgtt
accactgtatcaattgacggaacagcggtggacacctacgaaactgtttttggtatccgg
tctatcgcatacgatccaaatcaaggtcttctgatcaacggtgagcgcatctacgtgcag
gggtcctgcaaccaccacgatcttgggtcgctaggcgctgccttcaacgtacgtgctgcg
gagcgccagattgagattcttatggagatgggcaacaatgctctccggacttcgcataac
ccgccagcgcccgggtatctggatcttgctgaccgaatgggcctactagtcatggacgag
atttttgatacctggaattacgccaaggtagaaaacgactttcatcgcattttccaagaa
tggcatgagcccgaccttcgttcattcatccgtcgcgatcggaaccatccttctattatc
tcttggtctgttggcaatgaacttcgggaacaatccaacgctactggcactgcaaccgtc
aagatgcttcaagatattgctcatgaggaagaccctactcgaaaagttaccattggtatg
aacaatgccaatgcaagcactggagttgctgcaaccatcgacattatcggtctaaactac
cagggagaaggcaaaggtgtctcttggcgaagctcattccccgatttcaagaacgcattt
cccgagaagatgatttggagtaccgagtctgcttctactatcagttctcgtggcaagtac
ctgttccctgtcacttccaacaagagcgcagtaatcggcggagggcctggcgaaggcgga
gatcctgtgacgaatcagattagttcttacgatctctacgcaccggaatgggccgcatcc
ccagacaaagtcttccaaatgcaagacatgcacccttatgttgcaggagagttcgtctgg
actggatgggattacattggtgagcccacgccatatgccaatgtaagccgtagctcctat
tttggtatcatcgatctcgcaggtttcaagaaggaccgcttctatctctaccaatcccgc
tggaggtctgatcttcccatggcacatattctgcctcactggacctggccagaggaccgt
actggcgagaccacccctgtgcacgtatacagctctggtgatgcagccgaactcttcgta
aacggtgtttctgctggtcgcaaggaaaaggcagaatacgaataccgcttccgttgggat
gatatcaagtacagtcctggcaacgtcaccgtagtaacttacaaggatggtgcagaatgg
gcaaccgcatcacaagttacagcgggatctgccgcctcgctcaacatcactgcagaccgt
tctaccatcactggtgacggctacgacctttctttcgtctctgtggccgtacatgatagc
cagggtactctcgttccgacggccgaccacgcaatcagcttcaaggtcacatccggccct
ggtatcattgttagcacggataacggcgacccaacagatctggtgccgttcccaaagacg
acaaggaaagctttcggcggtttggcgctggctattgtaaggagtgaggctggtgcaacc
ggagagattgtggttgaagccacggcggagggcctggagggcggcagtgtgactattact
gctgcctga

DBGET integrated database retrieval system