KEGG   Bipolaris oryzae: COCMIDRAFT_97017Help
Entry
COCMIDRAFT_97017  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bor  Bipolaris oryzae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCMIDRAFT_97017
   00051 Fructose and mannose metabolism
    COCMIDRAFT_97017
   00052 Galactose metabolism
    COCMIDRAFT_97017
   00500 Starch and sucrose metabolism
    COCMIDRAFT_97017
   00520 Amino sugar and nucleotide sugar metabolism
    COCMIDRAFT_97017
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    COCMIDRAFT_97017
Enzymes [BR:bor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     COCMIDRAFT_97017
Membrane trafficking [BR:bor04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    COCMIDRAFT_97017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MTTVLGSMADMPRDLKEQIEKLEEQFVVSTEKIKHISDHFVSELEKGLSEQGGSIPMIPT
WCMAFPDGNETGKYLALDMGGTNLRVCEVTLTEEKGEFEIIQSKYRMPEELKTGTADELW
GYVADCLQQFIEYHHEGEQLADLPLGFTFSYPVSQDAIDHGVLQRWTKGFDVQGVEGVDV
VPGFKAALEERGVPIKLAALVNDTTGTMIASAYTDTSIKIGCIFGTGCNAAYMEECGAIP
KLKHMNLDPKLPMAINCEWGAFDNEHQVLPRTKYDVIIDKESPRPGQQTFEKMVAGLYLG
EIFRLVLLDLHKGTECSMFEGQNASKLDKPYSLDAGFLSQIEEDRFENLQDTADLFQETL
GITCTKPELELIRRLAELIGTRAARLTACGVSAICKHKKWSEVHVGADGSVFSKYPHFKI
RQAQALKEIMDWPAKYGKGKNDPIEVLPAEDGSGVGAALIAALTVKRAQQGQLAGIRDQD
ALLAMGKTNKK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtgttaggctcaatggcggacatgccccgggatctgaaggagcagatcgag
aagctggaggagcagtttgtcgtctccacggaaaagattaagcacatctcggatcacttt
gttagtgagctggagaagggactatcagagcaaggcggaagcattcctatgatcccgact
tggtgcatggcctttcccgatggcaacgagaccggaaaatatcttgcgcttgacatgggc
ggtacgaacctacgtgtttgtgaggttaccctgacggaagagaagggagagtttgagatc
atacaatcaaagtaccgtatgcccgaggagctgaagactggaactgccgatgagctatgg
ggctatgtcgccgactgcctccagcaattcatcgaataccaccacgagggcgagcagctc
gccgatcttcctctcggtttcaccttctcgtaccctgtctcgcaagatgctattgaccac
ggtgtcctacagcgatggaccaagggattcgacgtacaaggcgtggagggtgtagacgtt
gtgcctggattcaaggcagccctggaggaacgcggcgtgcctatcaaactcgcagcgctg
gtcaacgacactaccggtaccatgattgcctcagcgtataccgataccagcatcaagatt
ggttgcatcttcggtacggggtgtaacgctgcctacatggaggagtgtggtgctattccc
aagctgaagcacatgaacctggacccaaaactaccaatggctatcaactgcgaatggggc
gcctttgacaacgaacaccaagttctaccacggacaaagtacgatgttataattgacaag
gagtcgcctcggccgggtcaacagacttttgaaaagatggttgcaggtctgtaccttggc
gagatcttccgtctagtcctcttggatcttcacaagggtacagaatgctccatgttcgaa
ggccagaatgccagcaagctcgacaagccttactctcttgatgctggtttcctctctcag
atcgaagaagaccgcttcgagaatttgcaagatacggccgatctgttccaggagacactt
ggtatcacatgcactaagcctgaactcgagctcatccgtcgacttgctgagttgattggt
acccgcgctgctcgtctgactgcctgtggtgtctccgctatctgcaagcacaagaaatgg
agcgaggtacatgttggcgctgacggctccgtattcagcaagtatcctcacttcaagatt
cgtcaagctcaggcactgaaggaaattatggactggccagccaagtacggaaagggcaag
aacgatcctattgaggtgctacctgccgaggacggttccggtgttggtgctgcgctcatt
gctgcgcttacggtcaagcgtgcgcaacagggacaactggctggtatcagggaccaggat
gcgctgcttgctatgggaaagaccaacaagaaatag

DBGET integrated database retrieval system