KEGG   Bosea sp. RAC05: BSY19_1415Help
Entry
BSY19_1415        CDS       T04462                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bos  Bosea sp. RAC05
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bos00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BSY19_1415
Enzymes [BR:bos01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BSY19_1415
Transporters [BR:bos02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSY19_1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1513829..1514485
Genome map
AA seq 218 aa AA seqDB search
MTSATLTISSKNYSSWSLRGWLLCMMADLEVEEHMLSADDPSTRAELLLLSPSFLVPCLT
HDGIKVWDTLAIAAYLDEIRPGAGLVPKDAAARAHCRAICGEMHSGFANLRSALPMNLKA
HYPGFKVWAGAQADIDRVTEIWRNCLSTYGGPYLFGKTLTMADAMYAPVCLRFLTYDVAL
DPACQAYCRTISAWPALRRWIEAAKAEPDDVEELDAEF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcgacactgaccatcagcagcaagaactactcgtcctggtcgctgcgtggt
tggctgctctgcatgatggctgacctcgaggtggaggagcacatgctctccgccgacgac
ccctcgacgcgggccgaactgctgctgctctcgccgtccttcctggtgccctgcctgacg
catgacggcatcaaggtctgggacacgctcgccatcgccgcctatctcgacgagatcagg
cccggtgccggcctcgtgccgaaggacgctgccgcccgcgcgcattgccgcgcgatctgc
ggcgagatgcattccggcttcgccaatctgcgctcggccctgccgatgaacctcaaggcg
cattatcccggcttcaaggtctgggccggcgcccaggccgatatcgaccgcgtcaccgag
atctggcgcaactgcctgtcgacctatggcgggccctatctcttcggcaagacgctgacc
atggcggatgcgatgtatgcccccgtctgcctgcggttcctgacctatgacgtggcgctc
gatcccgcctgccaggcctattgccgcacgatctcggcctggcccgccctgcggcgctgg
atcgaggccgccaaggccgagcccgacgacgtcgaagaactcgacgccgagttctga

DBGET integrated database retrieval system