KEGG   Bosea sp. RAC05: BSY19_3279Help
Entry
BSY19_3279        CDS       T04462                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bos  Bosea sp. RAC05
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bos00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY19_3279
  Energy metabolism
   00680 Methane metabolism
    BSY19_3279
Enzymes [BR:bos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BSY19_3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3448105..3450930)
Genome map
AA seq 941 aa AA seqDB search
MNDGVESAIGDEAALAARLLAEIAQARGDAREDPFGNPVLRVTLWLTRRMDRGELDVEAA
CALVRQLGREALRQRAGRLAAYVGLDGDGEAAFAALAGMLSGAACGAPDPVAAYREAVER
LRFAAVFTAHPTFGMSRRLAHALAAQASGEAGGEAVIGDAALSFRPDGRITLQDEFEQAR
YAVRHARDAIDRLNAALLRAAQGLAPERWHELAPCPVILASWVGCDTDGRTDIGWWDTLR
YRLESKQGQFARILEKLPAVPATAAVRELVGTALAAVERQLALAPPITTQPALPALQTFA
LALVNEREAALPEASRLIAALDEAIALSGDDDTTMALCLVRAGCVAHGVSIALPHFRLNA
SQLHNAMRGVIPLDEEPTQPAQRRAFLSAVNGLLAKVAPIAVDFGALAAERASATRMLMT
IAQIVKHVDGTKAVRFLVAETETGYTLLCALWLASRFGIADRVEISPLFETEDALEQGPR
IIDEALRSPHFRAYLKRHGRFCVQFGYSDSGRYIGQVAATFWIERLRIRICELLRRYDLA
EVELVIFDTHGESAGRGAHPGSLADRLAYLEPAWARAAFARAGLRSVRETSFQGSDGYLM
FGTPLLAAATVGRIAEAVLVPVAEEVADPIYDEPDFASEFFQTVREEMTALVDDPGYAAL
IGTFGPSLLDKTGSRPAARQSDAGGPTRIRHPRELRAIPNNAILQQLGWLANSVHGIGQA
AARAPDLFNAMRERSDRFDRAYRLAEHALAASDLDVLRAYLDSLDPGSWFDRARRTVREG
RRDELLAVGEALSRLDLAPSLRSLFWRLSSDALKLRTAATDVPEMPARLVALHALRLAAM
HGIWLRASHIPDFRPHAGITREVLVERLLRLDVPACLALLADIFPLRPDPTIGLDFGEPP
GPRETGTYEALHRDVIAPMQGLFELLREISGAIQHEIGAFG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacggggtcgagagcgcgatcggggacgaagcggcgctggccgcgcggctgctg
gccgagatcgcccaggcccggggcgatgcgcgcgaggaccccttcggcaacccggtcctg
cgcgtgacgctgtggctgacgcggcggatggaccgtggcgagctcgacgtcgaggcggcc
tgcgcgctggtgcggcagctggggcgggaggcgctgcgccagcgcgccgggcggctggcg
gcctatgtcgggctcgacggcgatggcgaggccgccttcgccgcgctcgccggaatgctc
tcgggcgctgcgtgcggcgcgccggatccggtggccgcctatcgcgaggccgtcgagcgg
ctgcgcttcgcggccgtcttcacggcccatccgaccttcggcatgagccgcaggctcgcc
catgcgctcgccgcgcaggccagcggggaggcgggcggcgaggcggtgatcggcgatgcc
gcgctgtccttccggcccgatgggcggatcacgctgcaggacgagttcgagcaggcgcgc
tatgccgtgcgccacgcccgcgacgcgatcgaccgcctgaacgccgcgctgctgcgggct
gcgcaggggctcgcgcccgagcgctggcacgaactggcgccgtgcccggtcatcctcgcc
tcctgggtcggctgcgacaccgacgggcgcaccgatatcggctggtgggacacgctgcgc
taccggctggaatcgaagcagggccagttcgcgcgcatcctggagaagctgccggccgtg
ccggcaaccgccgccgtgcgcgagctggtcggcacggcgctggcggcggtcgagcggcag
ctggcgctggcgccgccgatcacgactcagccggccctgccggcgctgcagaccttcgcg
ctggcgctggtcaacgagcgcgaggcggcgctgcccgaagcatcgcgcctgatcgcggcg
ctggacgaggccatcgcgctgtctggcgacgacgacacgacgatggcgctctgcctggtc
agggccggctgcgtcgcccatggcgtctcgatcgcgctgccgcatttccggctcaacgcc
tcgcagctccacaacgccatgcgcggcgtgatcccgctcgacgaggagccgacgcagccg
gcgcagcgacgcgcctttctctcggcggtgaacggtttgttggcgaaagtcgcgccgatc
gcggttgatttcggcgcgctggcggccgagcgcgcctcggcgacgcgcatgctgatgacg
atcgcgcagatcgtgaagcatgtggatggcacgaaggcggtgcggtttctcgtggccgag
accgagaccggctacacgctgctctgcgcgctctggctcgccagccgcttcggcatcgcc
gaccgcgtcgagatctcgccgctgttcgagacggaagacgcgctggagcaggggccgcgc
atcatcgacgaggcgctgcgcagcccgcatttccgcgcctatctcaagcgccatggccgc
ttctgcgtgcagttcggctattccgattccggccgctatatcgggcaggtcgcggcgacc
ttctggatcgagcggctgcgcatccgcatctgcgagctgctgcgccgctacgacctcgcc
gaggtcgagctcgtcatcttcgacacccatggcgaatccgccgggcgcggcgcccatccg
ggcagcctcgccgaccggctggcctatctcgaacccgcctgggcgcgcgcggccttcgcc
agggccggcctgcgctcggtgcgcgaaaccagcttccagggcagcgacggctatctgatg
ttcggcacgccgctgctggcggcggcgaccgtcgggcgcatcgcggaagcggtgctggtg
cccgtggcggaggaggtcgccgatccgatctatgacgagcccgacttcgccagcgagttc
ttccagaccgtgcgcgaggaaatgacggcgctggtcgacgaccccggctatgccgcgctg
atcggcaccttcggcccctcgctgctcgacaagaccggctcgcgccccgccgcgcgccag
agcgatgccggcgggccgacgcgtatccgccatccgcgcgagctgcgcgcgatccccaac
aacgcgatcctgcagcagctcggctggctcgccaacagcgtccacggcatcggccaggcg
gcggcgcgcgcgcccgatctgttcaacgcgatgcgcgagcgctccgaccgcttcgaccgg
gcctatcgcctggcggagcatgcgctcgccgccagcgacctcgacgtgctgcgcgcctat
cttgactcgctcgaccccggcagctggttcgaccgggcgcggcgcaccgtgcgcgagggc
cggcgagacgagctgctcgcggtcggcgaggcgctgtcgcggctcgatctcgcgccttcg
ctgcgcagcctgttctggcggttgtcctcggacgcgctgaagctgcggacggctgcgacc
gatgtgccggagatgccggcgcggctggtggcgctgcatgcgctgcggctggcggcgatg
cacggcatctggctgcgcgccagccatatcccggatttccggccccatgccggcatcacc
cgcgaggtgctggtcgagcggctgctgcggctcgacgtgccggcctgcctggcgctgctc
gccgacatcttcccgctgcgacccgacccgaccatcgggctcgatttcggcgagccgccg
ggcccgcgcgagaccggcacctatgaggcgctgcaccgcgacgtgatcgcgccgatgcag
ggcctgttcgagctgctgcgcgagatctccggcgcgatccagcacgagatcggcgccttc
ggatag

DBGET integrated database retrieval system