KEGG   Brucella ovis: BOV_1042Help
Entry
BOV_1042          CDS       T00534                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bov  Brucella ovis
Pathway
bov00340  Histidine metabolism
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BOV_1042 (hisI)
Enzymes [BR:bov01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BOV_1042 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ABQ60727
UniProt: A0A0H3AR00
LinkDB All DBs
Position
I:1056261..1056620
Genome map
AA seq 119 aa AA seqDB search
MPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLKTGIAHYWSRSRKTLWKKGETSG
NLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYRQVVSSGGKVALTMASDHDQ
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactgaaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggcaagcgatcacgatcaataa

DBGET integrated database retrieval system